• Gene id: 5887

Gene Summary

• Gene Symbol: RAD23B   Gene   UCSC   Ensembl
• Aliases: HHR23B, HR23B, P58
• Gene name: RAD23 homolog B, nucleotide excision repair protein
• Alternate names: UV excision repair protein RAD23 homolog B, RAD23, yeast homolog of, B, XP-C repair complementing complex 58 kDa, XP-C repair complementing protein, XP-C repair-complementing complex 58 kDa protein,
• Gene location: 9q31.2 (30727998: 30678060)     Exons: 13     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the
• OMIM: 600062

Protein Summary

• Protein general information: P54727  
  • Name: UV excision repair protein RAD23 homolog B (HR23B) (hHR23B) (XP C repair complementing complex 58 kDa protein) (p58)
  • Length: 409  
  • Mass: 43,171
• Sequence:

  MQVTLKTLQQQTFKIDIDPEETVKALKEKIESEKGKDAFPVAGQKLIYAGKILNDDTALKEYKIDEKNFVVVMVT
  KPKAVSTPAPATTQQSAPASTTAVTSSTTTTVAQAPTPVPALAPTSTPASITPASATASSEPAPASAAKQEKPAE
  KPAETPVATSPTATDSTSGDSSRSNLFEDATSALVTGQSYENMVTEIMSMGYEREQVIAALRASFNNPDRAVEYL
  LMGIPGDRESQAVVDPPQAASTGAPQSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP
  ALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGGGGGSGGIAEAGSGHMNYIQVTPQEKEAIERLKA
  LGFPEGLVIQAYFACEKNENLAANFLLQQNFDED

• Structural information:
  • Protein Domains: Ubiquitin-like. (1-79)
    UBA (188-228)
    STI1 (274-317)
    UBA (364-404)
  • Interpro: IPR004806  IPR006636  IPR015940  IPR009060  IPR029071   IPR000626  IPR015360  IPR036353  
  • Prosite: PS50030 PS50053
  • PDB: 1P1A 1PVE 1UEL
  • PDBsum: 1P1A 1PVE 1UEL
  • DIP: 39944
  • STRING: ENSP00000350708
• Other Databases: GeneCards:  RAD23B  Malacards:  RAD23B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000502	proteasome complex	IEA	cellular component
GO:0000715	nucleotide-excision repair, DNA damage recognition	IDA	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0031593	polyubiquitin binding	IDA	molecular function
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0048568	embryonic organ development	IEA	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0071942	XPC complex	IDA	cellular component
GO:0000502	proteasome complex	IEA	cellular component
GO:0000715	nucleotide-excision repair, DNA damage recognition	IDA	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006289	nucleotide-excision repair	TAS	biological process
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0031593	polyubiquitin binding	IDA	molecular function
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0048568	embryonic organ development	IEA	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0071942	XPC complex	IDA	cellular component
GO:0000715	nucleotide-excision repair, DNA damage recognition	IDA	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0000717	nucleotide-excision repair, DNA duplex unwinding	TAS	biological process
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	TAS	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006289	nucleotide-excision repair	TAS	biological process
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0006294	nucleotide-excision repair, preincision complex assembly	TAS	biological process
GO:0031593	polyubiquitin binding	IDA	molecular function
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0070911	global genome nucleotide-excision repair	TAS	biological process
GO:0071942	XPC complex	IDA	cellular component

Diseases

Associated diseases	References
Cancer (Biliary tract neoplasms)	GAD: 18708406
Cancer (bladder)	GAD: 16537713
Cancer (lung)	GAD: 15849729
Cancer (lymphoma)	GAD: 18830263
Cancer	GAD: 19692168
Cancer (brain)	GAD: 20150366
Cancer (colorectal)	GAD: 16492920
Cancer (esophageal)	GAD: 19270000
Cancer (laryngeal)	GAD: 19444904
Cancer (leukemia)	GAD: 19074885
Cancer (breast)	GAD: 16399771
Multiple sclerosis	GAD: 20522537
Chronic renal failure	GAD: 21085059
Male factor infertility	MIK: 15120973
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 21412036
Male infertility	MIK: 15120973
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881