• Gene id: 5886

Gene Summary

• Gene Symbol: RAD23A   Gene   UCSC   Ensembl
• Aliases: HHR23A, HR23A
• Gene name: RAD23 homolog A, nucleotide excision repair protein
• Alternate names: UV excision repair protein RAD23 homolog A, RAD23, yeast homolog, A,
• Gene location: 19p13.13 (107283235: 107332193)     Exons: 12     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in nucleotide excision repair. Proteins in this family have a modular domain structure consisting of an ubiquitin-like domain (UbL), ubiqui
• OMIM: 600061

Protein Summary

• Protein general information: P54725  
  • Name: UV excision repair protein RAD23 homolog A (HR23A) (hHR23A)
  • Length: 363  
  • Mass: 39,609
• Sequence:

  MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVM
  VTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGRE
  EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATE
  AAGENPLEFLRDQPQFQNMRQVIQQNPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE
  VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENLAANFLLSQNFDDE

• Structural information:
  • Protein Domains: Ubiquitin-like. (1-81)
    UBA (161-201)
    UBA (318-358)
  • Interpro: IPR004806  IPR006636  IPR015940  IPR009060  IPR029071   IPR000626  IPR015360  IPR036353  
  • Prosite: PS50030 PS50053
  • PDB: 1DV0 1F4I 1IFY 1OQY 1P98 1P9D 1QZE 1TP4 1ZO6 2WYQ 5XBO
  • PDBsum: 1DV0 1F4I 1IFY 1OQY 1P98 1P9D 1QZE 1TP4 1ZO6 2WYQ 5XBO
  • DIP: 34442
  • STRING: ENSP00000467024
• Other Databases: GeneCards:  RAD23A  Malacards:  RAD23A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000502	proteasome complex	IEA	cellular component
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0016032	viral process	IEA	biological process
GO:0031593	polyubiquitin binding	IDA	molecular function
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0000502	proteasome complex	IEA	cellular component
GO:0003684	damaged DNA binding	IEA	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0006289	nucleotide-excision repair	IEA	biological process
GO:0006289	nucleotide-excision repair	TAS	biological process
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0016032	viral process	IEA	biological process
GO:0031593	polyubiquitin binding	IDA	molecular function
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function
GO:0003697	single-stranded DNA binding	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006289	nucleotide-excision repair	TAS	biological process
GO:0006289	nucleotide-excision repair	IDA	biological process
GO:0031593	polyubiquitin binding	IDA	molecular function
GO:0032434	regulation of proteasomal ubiquitin-dependent protein catabolic process	IDA	biological process
GO:0045070	positive regulation of viral genome replication	IMP	biological process
GO:1990381	ubiquitin-specific protease binding	IPI	molecular function

Diseases

Associated diseases	References
Cancer (breast)	GAD: 20496165
Multiple sclerosis	GAD: 20522537
Male factor infertility	MIK: 15120973
Male infertility	MIK: 15120973
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
15120973	Male infertility			8 testis biopsies	Male infertility	Vim Rad23A Rad23B Gsr Gstp 1 Mgst1 Ace Casp1 Ctsd Prlr Tmsb4 and Zfp-37 Hsp 1 Osp94
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)