• Gene id: 5885

Gene Summary

• Gene Symbol: RAD21   Gene   UCSC   Ensembl
• Aliases: CDLS4, HR21, HRAD21, MCD1, MGS, NXP1, SCC1, hHR21
• Gene name: RAD21 cohesin complex component
• Alternate names: double-strand-break repair protein rad21 homolog, NXP-1, RAD21 homolog, SCC1 homolog, kleisin, nuclear matrix protein 1, protein involved in DNA double-strand break repair, sister chromatid cohesion 1,
• Gene location: 8q24.11 (116874775: 116845933)     Exons: 13     NC_000008.11
• Gene summary(Entrez): The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad21, a gene involved in the repair of DNA double-strand breaks, as well as in chromatid cohesion during mitosis. This protein is a nuclear phospho-protei
• OMIM: 606462

Protein Summary

• Protein general information: O60216  
  • Name: Double strand break repair protein rad21 homolog (hHR21) (Nuclear matrix protein 1) (NXP 1) (SCC1 homolog) [Cleaved into: 64 kDa C terminal product (64 kDa carboxy terminal product) (65 kDa carboxy terminal product)]
  • Length: 631  
  • Mass: 71690
  • Tissue specificity: Expressed in the gut (at protein level). {ECO
• Sequence:

  MFYAHFVLSKRGPLAKIWLAAHWDKKLTKAHVFECNLESSVESIISPKVKMALRTSGHLLLGVVRIYHRKAKYLL
  ADCNEAFIKIKMAFRPGVVDLPEENREAAYNAITLPEEFHDFDQPLPDLDDIDVAQQFSLNQSRVEEITMREEVG
  NISILQENDFGDFGMDDREIMREGSAFEDDDMLVSTTTSNLLLESEQSTSNLNEKINHLEYEDQYKDDNFGEGND
  GGILDDKLISNNDGGIFDDPPALSEAGVMLPEQPAHDDMDEDDNVSMGGPDSPDSVDPVEPMPTMTDQTTLVPNE
  EEAFALEPIDITVKETKAKRKRKLIVDSVKELDSKTIRAQLSDYSDIVTTLDLAPPTKKLMMWKETGGVEKLFSL
  PAQPLWNNRLLKLFTRCLTPLVPEDLRKRRKGGEADNLDEFLKEFENPEVPREDQQQQHQQRDVIDEPIIEEPSR
  LQESVMEASRTNIDESAMPPPPPQGVKRKAGQIDPEPVMPPQQVEQMEIPPVELPPEEPPNICQLIPELELLPEK
  EKEKEKEKEDDEEEEDEDASGGDQDQEERRWNKRTQQMLHGLQRALAKTGAESISLLELCRNTNRKQAAAKFYSF
  LVLKKQQAIELTQEEPYSDIIATPGPRFHII

• Structural information:
  • Interpro: IPR039781  IPR006909  IPR006910  IPR036390  
  • PDB: 4PJU 4PJW 4PK7 6QNX 6RRC 6RRK
  • PDBsum: 4PJU 4PJW 4PK7 6QNX 6RRC 6RRK
  • DIP: 29201
  • STRING: ENSP00000297338
• Other Databases: GeneCards:  RAD21  Malacards:  RAD21

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006302	double-strand break repair	IBA	biological process
GO:0030893	meiotic cohesin complex	IBA	cellular component
GO:0000798	nuclear cohesin complex	IBA	cellular component
GO:0003682	chromatin binding	IBA	molecular function
GO:0007062	sister chromatid cohesion	IBA	biological process
GO:0051321	meiotic cell cycle	IBA	biological process
GO:0008278	cohesin complex	IDA	cellular component
GO:0045876	positive regulation of sister chromatid cohesion	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0071168	protein localization to chromatin	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007062	sister chromatid cohesion	IEA	biological process
GO:0008278	cohesin complex	IEA	cellular component
GO:0006281	DNA repair	IEA	biological process
GO:0051301	cell division	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0005694	chromosome	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0007059	chromosome segregation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0006915	apoptotic process	IEA	biological process
GO:0006302	double-strand break repair	TAS	biological process
GO:0006310	DNA recombination	TAS	biological process
GO:0007131	reciprocal meiotic recombination	TAS	biological process
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0000775	chromosome, centromeric region	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005694	chromosome	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000794	condensed nuclear chromosome	IEA	cellular component
GO:0045841	negative regulation of mitotic metaphase/anaphase transition	IEA	biological process
GO:0010972	negative regulation of G2/M transition of mitotic cell cycle	IEA	biological process
GO:0008278	cohesin complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000785	chromatin	IEA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0008278	cohesin complex	TAS	cellular component
GO:0016363	nuclear matrix	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0000922	spindle pole	IEA	cellular component
GO:0000775	chromosome, centromeric region	IEA	cellular component
GO:0005694	chromosome	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008278	cohesin complex	IDA	cellular component
GO:0016363	nuclear matrix	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04110	Cell cycle

Diseases

Associated diseases	References
Cornelia de Lange syndrome	KEGG:H00631
Cornelia de Lange syndrome	KEGG:H00631
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R