• Gene id: 5884

Gene Summary

• Gene Symbol: RAD17   Gene   UCSC   Ensembl
• Aliases: CCYC, HRAD17, R24L, RAD17SP, RAD24
• Gene name: RAD17 checkpoint clamp loader component
• Alternate names: cell cycle checkpoint protein RAD17, RAD1 homolog, RAD17 homolog, RF-C activator 1 homolog, Rad17-like protein, cell cycle checkpoint protein (RAD17),
• Gene location: 5q13.2 (69369296: 69414800)     Exons: 21     NC_000005.10
• Gene summary(Entrez): The protein encoded by this gene is highly similar to the gene product of Schizosaccharomyces pombe rad17, a cell cycle checkpoint gene required for cell cycle arrest and DNA damage repair in response to DNA damage. This protein shares strong similarity w
• OMIM: 603139

Protein Summary

• Protein general information: O75943  
  • Name: Cell cycle checkpoint protein RAD17 (hRad17) (RF C/activator 1 homolog)
  • Length: 681  
  • Mass: 77055
  • Tissue specificity: Overexpressed in various cancer cell lines and in colon carcinoma (at protein level). Isoform 2 and isoform 3 are the most abundant isoforms in non irradiated cells (at protein level). Ubiquitous at low levels. Highly expressed in test
• Sequence:

  MSKTFLRPKVSSTKVTDWVDPSFDDFLECSGVSTITATSLGVNNSSHRRKNGPSTLESSRFPARKRGNLSSLEQI
  YGLENSKEYLSENEPWVDKYKPETQHELAVHKKKIEEVETWLKAQVLERQPKQGGSILLITGPPGCGKTTTLKIL
  SKEHGIQVQEWINPVLPDFQKDDFKGMFNTESSFHMFPYQSQIAVFKEFLLRATKYNKLQMLGDDLRTDKKIILV
  EDLPNQFYRDSHTLHEVLRKYVRIGRCPLIFIISDSLSGDNNQRLLFPKEIQEECSISNISFNPVAPTIMMKFLN
  RIVTIEANKNGGKITVPDKTSLELLCQGCSGDIRSAINSLQFSSSKGENNLRPRKKGMSLKSDAVLSKSKRRKKP
  DRVFENQEVQAIGGKDVSLFLFRALGKILYCKRASLTELDSPRLPSHLSEYERDTLLVEPEEVVEMSHMPGDLFN
  LYLHQNYIDFFMEIDDIVRASEFLSFADILSGDWNTRSLLREYSTSIATRGVMHSNKARGYAHCQGGGSSFRPLH
  KPQWFLINKKYRENCLAAKALFPDFCLPALCLQTQLLPYLALLTIPMRNQAQISFIQDIGRLPLKRHFGRLKMEA
  LTDREHGMIDPDSGDEAQLNGGHSAEESLGEPTQATVPETWSLPLSQNSASELPASQPQPFSAQGDMEENIIIED
  YESDGT

• Structural information:
  • Interpro: IPR004582  IPR027417  IPR018324  
  • DIP: 24254 34896
  • STRING: ENSP00000426191
• Other Databases: GeneCards:  RAD17  Malacards:  RAD17

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000077	DNA damage checkpoint	IBA	biological process
GO:0003682	chromatin binding	IBA	molecular function
GO:0006281	DNA repair	IBA	biological process
GO:0000790	nuclear chromatin	IBA	cellular component
GO:0033314	mitotic DNA replication checkpoint	IBA	biological process
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0031389	Rad17 RFC-like complex	IEA	cellular component
GO:0042025	host cell nucleus	IEA	cellular component
GO:0003689	DNA clamp loader activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0007049	cell cycle	IEA	biological process
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0000076	DNA replication checkpoint	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0000781	chromosome, telomeric region	IDA	colocalizes with
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IDA	cellular component
GO:0008156	negative regulation of DNA replication	IMP	biological process
GO:0007093	mitotic cell cycle checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000077	DNA damage checkpoint	IMP	biological process
GO:0042325	regulation of phosphorylation	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881