• Gene id: 5883

Gene Summary

• Gene Symbol: RAD9A   Gene   UCSC   Ensembl
• Aliases: RAD9
• Gene name: RAD9 checkpoint clamp component A
• Alternate names: cell cycle checkpoint control protein RAD9A, DNA repair exonuclease rad9 homolog A, RAD9 homolog A, hRAD9,
• Gene location: 11q13.2 (67391975: 67398411)     Exons: 8     NC_000011.10
• Gene summary(Entrez): This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair. This protein possesses 3' to 5' exonuclease activity, which may contribute to its role in sensing
• OMIM: 603761

Protein Summary

• Protein general information: Q99638  
  • Name: Cell cycle checkpoint control protein RAD9A (hRAD9) (EC 3.1.11.2) (DNA repair exonuclease rad9 homolog A)
  • Length: 391  
  • Mass: 42547
• Sequence:

  MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQYQAATPGQDLLRCKI
  LMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRKTHNLSFQDCESLQAVFDPASCPHMLRAPAR
  VLGEAVLPFSPALAEVTLGIGRGRRVILRSYHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGL
  LSFAESANLNLSIHFDAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFAN
  DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKKFRSLFFGSILAPVRS
  PQGPSPVLAEDSEGEG

• Structural information:
  • Interpro: IPR026584  IPR007268  
  • PDB: 3A1J 3G65 3GGR 6HM5 6J8Y
  • PDBsum: 3A1J 3G65 3GGR 6HM5 6J8Y
  • DIP: 24255 40930
  • STRING: ENSP00000311360
• Other Databases: GeneCards:  RAD9A  Malacards:  RAD9A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000076	DNA replication checkpoint	IBA	biological process
GO:0006281	DNA repair	IBA	biological process
GO:0008408	3'-5' exonuclease activity	IBA	molecular function
GO:0030896	checkpoint clamp complex	IBA	cellular component
GO:0031573	intra-S DNA damage checkpoint	IBA	biological process
GO:0071479	cellular response to ionizing radiation	IBA	biological process
GO:0071479	cellular response to ionizing radiation	IDA	biological process
GO:0000077	DNA damage checkpoint	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000077	DNA damage checkpoint	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0030896	checkpoint clamp complex	IEA	cellular component
GO:0004518	nuclease activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0000076	DNA replication checkpoint	TAS	biological process
GO:0000077	DNA damage checkpoint	TAS	biological process
GO:0006281	DNA repair	TAS	biological process
GO:0008853	exodeoxyribonuclease III activity	IEA	molecular function
GO:1901796	regulation of signal transduction by p53 class mediator	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0006260	DNA replication	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:1902231	positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0031573	intra-S DNA damage checkpoint	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0008408	3'-5' exonuclease activity	IDA	molecular function
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0042826	histone deacetylase binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04218	Cellular senescence

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogonia differentiation	MIK: 27861152
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
27861152	Spermatogonia differentiation				Male infertility