• Gene id: 5881

Gene Summary

• Gene Symbol: RAC3   Gene   UCSC   Ensembl
• Gene name: Rac family small GTPase 3
• Alternate names: ras-related C3 botulinum toxin substrate 3, p21-Rac3, ras-related C3 botulinum toxin substrate 3 (rho family, small GTP binding protein Rac3), rho family, small GTP binding protein Rac3,
• Gene location: 17q25.3 (82031677: 82034203)     Exons: 6     NC_000017.11
• Gene summary(Entrez): The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorgani
• OMIM: 615061

Protein Summary

• Protein general information: P60763  
  • Name: Ras related C3 botulinum toxin substrate 3 (EC 3.6.5.2) (p21 Rac3)
  • Length: 192  
  • Mass: 21379
  • Tissue specificity: Highest levels in brain, also detected in heart, placenta and pancreas.
• Sequence:

  MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQT
  DVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIG
  SVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKCTVF

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • PDB: 2C2H 2G0N 2IC5 2OV2 2QME 6TM1
  • PDBsum: 2C2H 2G0N 2IC5 2OV2 2QME 6TM1
  • DIP: 33881
  • STRING: ENSP00000304283
• Other Databases: GeneCards:  RAC3  Malacards:  RAC3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0005938	cell cortex	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0030865	cortical cytoskeleton organization	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0042995	cell projection	IBA	cellular component
GO:0043005	neuron projection	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0033630	positive regulation of cell adhesion mediated by integrin	IDA	biological process
GO:0016055	Wnt signaling pathway	IMP	biological process
GO:0048306	calcium-dependent protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005856	cytoskeleton	IEA	cellular component
GO:0043005	neuron projection	IDA	cellular component
GO:0043025	neuronal cell body	IDA	cellular component
GO:0031941	filamentous actin	IDA	cellular component
GO:0030426	growth cone	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051932	synaptic transmission, GABAergic	IEA	biological process
GO:0050905	neuromuscular process	IEA	biological process
GO:0050885	neuromuscular process controlling balance	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0031175	neuron projection development	IEA	biological process
GO:0021894	cerebral cortex GABAergic interneuron development	IEA	biological process
GO:0014041	regulation of neuron maturation	IEA	biological process
GO:0022604	regulation of cell morphogenesis	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0012505	endomembrane system	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0030036	actin cytoskeleton organization	IDA	biological process
GO:0030031	cell projection assembly	IDA	biological process
GO:0012505	endomembrane system	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04010	MAPK signaling pathway
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa04310	Wnt signaling pathway
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04071	Sphingolipid signaling pathway
hsa04650	Natural killer cell mediated cytotoxicity
hsa05231	Choline metabolism in cancer
hsa04662	B cell receptor signaling pathway
hsa05210	Colorectal cancer
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa04520	Adherens junction
hsa04370	VEGF signaling pathway
hsa05416	Viral myocarditis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq