• Gene id: 5879

Gene Summary

• Gene Symbol: RAC1   Gene   UCSC   Ensembl
• Aliases: MIG5, MRD48, Rac-1, TC-25, p21-Rac1
• Gene name: Rac family small GTPase 1
• Alternate names: ras-related C3 botulinum toxin substrate 1, cell migration-inducing gene 5 protein, ras-like protein TC25, ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1),
• Gene location: 7p22.1 (6374526: 6403966)     Exons: 7     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a GTPase which belongs to the RAS superfamily of small GTP-binding proteins. Members of this superfamily appear to regulate a diverse array of cellular events, including the control of cell growth, cytoskeletal reorgani
• OMIM: 602048

Protein Summary

• Protein general information: P63000  
  • Name: Ras related C3 botulinum toxin substrate 1 (EC 3.6.5.2) (Cell migration inducing gene 5 protein) (Ras like protein TC25) (p21 Rac1)
  • Length: 192  
  • Mass: 21450
  • Tissue specificity: Isoform B is predominantly identified in skin and epithelial tissues from the intestinal tract. Its expression is elevated in colorectal tumors at various stages of neoplastic progression, as compared to their respective adjacent tissu
• Sequence:

  MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQT
  DVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLTPITYPQGLAMAKEIG
  AVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • PDB: 1E96 1FOE 1G4U 1HE1 1HH4 1I4D 1I4L 1I4T 1MH1 1RYF 1RYH 2FJU 2H7V 2NZ8 2P2L 2RMK 2VRW 2WKP 2WKQ 2WKR 2YIN 3B13 3BJI 3RYT 3SBD 3SBE 3SU8 3SUA 3TH5 4GZL 4GZM 4YON 5FI0 5HZH 5N6O 5O33 5QQD 5QQE 5QQF 5QQG 5QQH 5QQI 5QQJ 5QQK 5QQL 5QQM 5QQN 6AGP 6BC1
  • PDBsum: 1E96 1FOE 1G4U 1HE1 1HH4 1I4D 1I4L 1I4T 1MH1 1RYF 1RYH 2FJU 2H7V 2NZ8 2P2L 2RMK 2VRW 2WKP 2WKQ 2WKR 2YIN 3B13 3BJI 3RYT 3SBD 3SBE 3SU8 3SUA 3TH5 4GZL 4GZM 4YON 5FI0 5HZH 5N6O 5O33 5QQD 5QQE 5QQF 5QQG 5QQH 5QQI 5QQJ 5QQK 5QQL 5QQM 5QQN 6AGP 6BC1
  • DIP: 29260
  • STRING: ENSP00000348461
• Other Databases: GeneCards:  RAC1  Malacards:  RAC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045428	regulation of nitric oxide biosynthetic process	ISS	biological process
GO:0036464	cytoplasmic ribonucleoprotein granule	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	NAS	biological process
GO:0043652	engulfment of apoptotic cell	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0042995	cell projection	IBA	cellular component
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0030865	cortical cytoskeleton organization	IBA	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0016601	Rac protein signal transduction	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0007015	actin filament organization	IBA	biological process
GO:0005938	cell cortex	IBA	cellular component
GO:0005525	GTP binding	IBA	molecular function
GO:0003924	GTPase activity	IBA	molecular function
GO:1902622	regulation of neutrophil migration	IBA	biological process
GO:0043197	dendritic spine	IBA	cellular component
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0008045	motor neuron axon guidance	IBA	biological process
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0048870	cell motility	IDA	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0030334	regulation of cell migration	IMP	biological process
GO:0030334	regulation of cell migration	IMP	biological process
GO:0001764	neuron migration	ISS	biological process
GO:0031996	thioesterase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001934	positive regulation of protein phosphorylation	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0006954	inflammatory response	TAS	biological process
GO:0007155	cell adhesion	TAS	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0009611	response to wounding	TAS	biological process
GO:0009653	anatomical structure morphogenesis	TAS	biological process
GO:0005525	GTP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0031529	ruffle organization	IDA	biological process
GO:0010592	positive regulation of lamellipodium assembly	IDA	biological process
GO:0030036	actin cytoskeleton organization	IGI	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0060071	Wnt signaling pathway, planar cell polarity pathway	TAS	biological process
GO:0101003	ficolin-1-rich granule membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0031295	T cell costimulation	TAS	biological process
GO:0038095	Fc-epsilon receptor signaling pathway	TAS	biological process
GO:0038096	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS	biological process
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0048013	ephrin receptor signaling pathway	TAS	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000139	Golgi membrane	IEA	cellular component
GO:0002551	mast cell chemotaxis	IEA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0007015	actin filament organization	IEA	biological process
GO:0016601	Rac protein signal transduction	IEA	biological process
GO:0017137	Rab GTPase binding	IEA	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0035774	positive regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0006935	chemotaxis	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0010592	positive regulation of lamellipodium assembly	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0043197	dendritic spine	IEA	cellular component
GO:0045428	regulation of nitric oxide biosynthetic process	IEA	biological process
GO:0045453	bone resorption	IEA	biological process
GO:0045740	positive regulation of DNA replication	IEA	biological process
GO:0051022	Rho GDP-dissociation inhibitor binding	IEA	molecular function
GO:0051117	ATPase binding	IEA	molecular function
GO:0071260	cellular response to mechanical stimulus	IEA	biological process
GO:0071526	semaphorin-plexin signaling pathway	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019899	enzyme binding	IPI	molecular function
GO:0007160	cell-matrix adhesion	NAS	biological process
GO:0051668	localization within membrane	IMP	biological process
GO:0032707	negative regulation of interleukin-23 production	IDA	biological process
GO:0060263	regulation of respiratory burst	IDA	biological process
GO:0010310	regulation of hydrogen peroxide metabolic process	TAS	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0043197	dendritic spine	IDA	cellular component
GO:0010591	regulation of lamellipodium assembly	IGI	biological process
GO:0010592	positive regulation of lamellipodium assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0051492	regulation of stress fiber assembly	IGI	biological process
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0031116	positive regulation of microtubule polymerization	IMP	biological process
GO:0048012	hepatocyte growth factor receptor signaling pathway	IMP	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:1900026	positive regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:0051496	positive regulation of stress fiber assembly	IDA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IDA	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005884	actin filament	IDA	colocalizes with
GO:0032587	ruffle membrane	IDA	cellular component
GO:0044877	protein-containing complex binding	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0055038	recycling endosome membrane	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0035025	positive regulation of Rho protein signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0030041	actin filament polymerization	TAS	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0010811	positive regulation of cell-substrate adhesion	IGI	biological process
GO:0008361	regulation of cell size	IMP	biological process
GO:0008361	regulation of cell size	IGI	biological process
GO:0010592	positive regulation of lamellipodium assembly	IMP	biological process
GO:0034446	substrate adhesion-dependent cell spreading	IMP	biological process
GO:0071526	semaphorin-plexin signaling pathway	ISS	biological process
GO:0051022	Rho GDP-dissociation inhibitor binding	ISS	molecular function
GO:0048261	negative regulation of receptor-mediated endocytosis	TAS	biological process
GO:0031529	ruffle organization	TAS	biological process
GO:0016020	membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0090023	positive regulation of neutrophil chemotaxis	IMP	biological process
GO:0005925	focal adhesion	HDA	cellular component
GO:0030032	lamellipodium assembly	IMP	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005525	GTP binding	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0010811	positive regulation of cell-substrate adhesion	IGI	biological process
GO:0097178	ruffle assembly	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0098794	postsynapse	IMP	cellular component
GO:0098794	postsynapse	IMP	cellular component
GO:0098794	postsynapse	IDA	cellular component
GO:0098794	postsynapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IMP	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component
GO:0098978	glutamatergic synapse	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05200	Pathways in cancer
hsa04151	PI3K-Akt signaling pathway
hsa04010	MAPK signaling pathway
hsa05131	Shigellosis
hsa04014	Ras signaling pathway
hsa04810	Regulation of actin cytoskeleton
hsa05132	Salmonella infection
hsa04015	Rap1 signaling pathway
hsa04024	cAMP signaling pathway
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05130	Pathogenic Escherichia coli infection
hsa04360	Axon guidance
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05205	Proteoglycans in cancer
hsa05169	Epstein-Barr virus infection
hsa04310	Wnt signaling pathway
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa04530	Tight junction
hsa04145	Phagosome
hsa04932	Non-alcoholic fatty liver disease
hsa04380	Osteoclast differentiation
hsa05418	Fluid shear stress and atherosclerosis
hsa05135	Yersinia infection
hsa04722	Neurotrophin signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04670	Leukocyte transendothelial migration
hsa04650	Natural killer cell mediated cytotoxicity
hsa05231	Choline metabolism in cancer
hsa04972	Pancreatic secretion
hsa04666	Fc gamma R-mediated phagocytosis
hsa04620	Toll-like receptor signaling pathway
hsa04662	B cell receptor signaling pathway
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05100	Bacterial invasion of epithelial cells
hsa05210	Colorectal cancer
hsa05120	Epithelial cell signaling in Helicobacter pylori infection
hsa04664	Fc epsilon RI signaling pathway
hsa05212	Pancreatic cancer
hsa04520	Adherens junction
hsa05211	Renal cell carcinoma
hsa05014	Amyotrophic lateral sclerosis
hsa04370	VEGF signaling pathway
hsa05416	Viral myocarditis
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Autosomal dominant mental retardation	KEGG:H00773
Autosomal dominant mental retardation	KEGG:H00773
Colon adenoma	PMID:12865273
colon adenocarcinoma	PMID:10597294
colon adenocarcinoma	PMID:19561401
pancreatic ductal adenocarcinoma	PMID:23334332
pancreatic adenocarcinoma	PMID:21037555
colorectal cancer	PMID:24833563
colorectal cancer	PMID:17597401
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray