• Gene id: 5876

Gene Summary

• Gene Symbol: RABGGTB   Gene   UCSC   Ensembl
• Aliases: GGTB
• Gene name: Rab geranylgeranyltransferase subunit beta
• Alternate names: geranylgeranyl transferase type-2 subunit beta, GGTase-II-beta, Rab geranylgeranyltransferase beta subunit, rab GG transferase beta, rab GGTase beta, type II protein geranyl-geranyltransferase subunit beta,
• Gene location: 1p31.1 (49848553: 49860743)     Exons: 16     NC_000019.10
• Gene summary(Entrez): This gene encodes the beta-subunit of the enzyme Rab geranylgeranyl-transferase (RabGGTase), which belongs to the protein prenyltransferase family. RabGGTase catalyzes the post-translational addition of geranylgeranyl groups to C-terminal cysteine residue
• OMIM: 179080

Protein Summary

• Protein general information: P53611  
  • Name: Geranylgeranyl transferase type 2 subunit beta (EC 2.5.1.60) (Geranylgeranyl transferase type II subunit beta) (GGTase II beta) (Rab geranyl geranyltransferase subunit beta) (Rab GG transferase beta) (Rab GGTase beta) (Rab geranylgeranyltransferase subuni
  • Length: 331  
  • Mass: 36924
• Sequence:

  MGTPQKDVIIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGIYWGLTVMDLMGQLHRMNREEILAFI
  KSCQHECGGISASIGHDPHLLYTLSAVQILTLYDSINVIDVNKVVEYVKGLQKEDGSFAGDIWGEIDTRFSFCAV
  ATLALLGKLDAINVEKAIEFVLSCMNFDGGFGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLP
  SGGLNGRPEKLPDVCYSWWVLASLKIIGRLHWIDREKLRNFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
  LGEEQIKPVNPVFCMPEEVLQRVNVQPELVS

• Structural information:
  • Interpro: IPR001330  IPR026873  IPR008930  
  • CDD: cd02894
  • PDB: 6J6X 6J74 6J7F 6J7X 6O60
  • PDBsum: 6J6X 6J74 6J7F 6J7X 6O60
  • STRING: ENSP00000317473
• Other Databases: GeneCards:  RABGGTB  Malacards:  RABGGTB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005968	Rab-protein geranylgeranyltransferase complex	IBA	cellular component
GO:0018342	protein prenylation	IBA	biological process
GO:0004663	Rab geranylgeranyltransferase activity	IBA	contributes to
GO:0018344	protein geranylgeranylation	IBA	biological process
GO:0017137	Rab GTPase binding	ISS	molecular function
GO:0008270	zinc ion binding	ISS	molecular function
GO:0005968	Rab-protein geranylgeranyltransferase complex	ISS	cellular component
GO:0018344	protein geranylgeranylation	ISS	biological process
GO:0004663	Rab geranylgeranyltransferase activity	ISS	molecular function
GO:0003824	catalytic activity	IEA	molecular function
GO:0004663	Rab geranylgeranyltransferase activity	IEA	molecular function
GO:0018344	protein geranylgeranylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0004659	prenyltransferase activity	IEA	molecular function
GO:0007601	visual perception	TAS	biological process
GO:0004663	Rab geranylgeranyltransferase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0006464	cellular protein modification process	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881