• Gene id: 5874

Gene Summary

• Gene Symbol: RAB27B   Gene   UCSC   Ensembl
• Aliases: C25KG
• Gene name: RAB27B, member RAS oncogene family
• Alternate names: ras-related protein Rab-27B,
• Gene location: 18q21.2 (54717841: 54895515)     Exons: 11     NC_000018.10
• Gene summary(Entrez): Members of the Rab protein family, including RAB27B, are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking (Chen et al., 1997 [PubMed 9066979]).[supplied by OMIM, Nov 2010]
• OMIM: 603869

Protein Summary

• Protein general information: O00194  
  • Name: Ras related protein Rab 27B (EC 3.6.5.2) (C25KG)
  • Length: 218  
  • Mass: 24608
  • Tissue specificity: Expressed primarily in testis.
• Sequence:

  MTDGDYDYLIKLLALGDSGVGKTTFLYRYTDNKFNPKFITTVGIDFREKRVVYNAQGPNGSSGKAFKVHLQLWDT
  AGQERFRSLTTAFFRDAMGFLLMFDLTSQQSFLNVRNWMSQLQANAYCENPDIVLIGNKADLPDQREVNERQARE
  LADKYGIPYFETSAATGQNVEKAVETLLDLIMKRMEQCVEKTQIPDTVNGGNSGNLDGEKPPEKKCIC

• Structural information:
  • Interpro: IPR027417  IPR041837  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04127
  • PDB: 2F7S
  • PDBsum: 2F7S
  • DIP: 48948
  • STRING: ENSP00000262094
• Other Databases: GeneCards:  RAB27B  Malacards:  RAB27B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0030141	secretory granule	IBA	cellular component
GO:0032402	melanosome transport	IBA	biological process
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0042470	melanosome	IBA	cellular component
GO:0045921	positive regulation of exocytosis	IBA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0005770	late endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	ISS	molecular function
GO:0003924	GTPase activity	ISS	molecular function
GO:0099641	anterograde axonal protein transport	ISS	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0002576	platelet degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0031088	platelet dense granule membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0099641	anterograde axonal protein transport	IEA	biological process
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0048488	synaptic vesicle endocytosis	IEA	biological process
GO:0042589	zymogen granule membrane	IEA	cellular component
GO:0030667	secretory granule membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0042470	melanosome	IDA	cellular component
GO:0032585	multivesicular body membrane	IDA	cellular component
GO:0030140	trans-Golgi network transport vesicle	IDA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0005795	Golgi stack	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0019904	protein domain specific binding	IPI	molecular function
GO:0045921	positive regulation of exocytosis	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031489	myosin V binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0071985	multivesicular body sorting pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa04972	Pancreatic secretion

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881