• Gene id: 5869

Gene Summary

• Gene Symbol: RAB5B   Gene   UCSC   Ensembl
• Gene name: RAB5B, member RAS oncogene family
• Alternate names: ras-related protein Rab-5B,
• Gene location: 12q13.2 (55973912: 55996682)     Exons: 8     NC_000012.12

Protein Summary

• Protein general information: P61020  
  • Name: Ras related protein Rab 5B
  • Length: 215  
  • Mass: 23707
• Sequence:

  MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQSVCLDDTTVKFEIWD
  TAGQERYHSLAPMYYRGAQAAIVVYDITNQETFARAKTWVKELQRQASPSIVIALAGNKADLANKRMVEYEEAQA
  YADDNSLLFMETSAKTAMNVNDLFLAIAKKLPKSEPQNLGGAAGRSRGVDLHEQSQQNKSQCCSN

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 2HEI
  • PDBsum: 2HEI
  • STRING: ENSP00000353444
• Other Databases: GeneCards:  RAB5B  Malacards:  RAB5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0030139	endocytic vesicle	IBA	cellular component
GO:0030100	regulation of endocytosis	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005769	early endosome	IBA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0003924	GTPase activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0016020	membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0007032	endosome organization	IEA	biological process
GO:0030100	regulation of endocytosis	IEA	biological process
GO:0030139	endocytic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0030742	GTP-dependent protein binding	IDA	molecular function
GO:0005768	endosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0019882	antigen processing and presentation	IMP	biological process
GO:0048227	plasma membrane to endosome transport	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa05146	Amoebiasis
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R