• Gene id: 5868

Gene Summary

• Gene Symbol: RAB5A   Gene   UCSC   Ensembl
• Aliases: RAB5
• Gene name: RAB5A, member RAS oncogene family
• Alternate names: ras-related protein Rab-5A, RAS-associated protein RAB5A,
• Gene location: 3p24.3 (19947079: 19985174)     Exons: 6     NC_000003.12
• OMIM: 179512

Protein Summary

• Protein general information: P20339  
  • Name: Ras related protein Rab 5A (EC 3.6.5.2)
  • Length: 215  
  • Mass: 23659
• Sequence:

  MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWD
  TAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQS
  YADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 1N6H 1N6I 1N6K 1N6L 1N6N 1N6O 1N6P 1N6R 1R2Q 1TU3 1TU4 3MJH 4Q9U
  • PDBsum: 1N6H 1N6I 1N6K 1N6L 1N6N 1N6O 1N6P 1N6R 1R2Q 1TU3 1TU4 3MJH 4Q9U
  • DIP: 380
  • STRING: ENSP00000273047
• Other Databases: GeneCards:  RAB5A  Malacards:  RAB5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005515	protein binding	IPI	molecular function
GO:0150093	amyloid-beta clearance by transcytosis	IGI	biological process
GO:0036465	synaptic vesicle recycling	IDA	biological process
GO:0036477	somatodendritic compartment	IDA	cellular component
GO:0043195	terminal bouton	IDA	cellular component
GO:2000300	regulation of synaptic vesicle exocytosis	IMP	biological process
GO:2000785	regulation of autophagosome assembly	TAS	biological process
GO:0005768	endosome	ISS	cellular component
GO:0008021	synaptic vesicle	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0030425	dendrite	ISS	cellular component
GO:0043025	neuronal cell body	ISS	cellular component
GO:0043679	axon terminus	ISS	cellular component
GO:0039694	viral RNA genome replication	IMP	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0012505	endomembrane system	IBA	cellular component
GO:0030424	axon	IBA	cellular component
GO:0030425	dendrite	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0051489	regulation of filopodium assembly	IBA	biological process
GO:0098993	anchored component of synaptic vesicle membrane	IBA	cellular component
GO:0006886	intracellular protein transport	IBA	biological process
GO:0006897	endocytosis	IBA	biological process
GO:0048169	regulation of long-term neuronal synaptic plasticity	IBA	biological process
GO:0098842	postsynaptic early endosome	IBA	cellular component
GO:0051489	regulation of filopodium assembly	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0006897	endocytosis	IDA	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0032009	early phagosome	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045335	phagocytic vesicle	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0006909	phagocytosis	IEA	biological process
GO:0015031	protein transport	IEA	biological process
GO:0006897	endocytosis	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003924	GTPase activity	TAS	molecular function
GO:0005769	early endosome	TAS	cellular component
GO:0006897	endocytosis	TAS	biological process
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0006661	phosphatidylinositol biosynthetic process	TAS	biological process
GO:0010008	endosome membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007596	blood coagulation	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0031901	early endosome membrane	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006897	endocytosis	IEA	biological process
GO:0019001	guanyl nucleotide binding	IEA	molecular function
GO:0030139	endocytic vesicle	IEA	cellular component
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005768	endosome	IEA	cellular component
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0032009	early phagosome	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:2000286	receptor internalization involved in canonical Wnt signaling pathway	IMP	biological process
GO:0005829	cytosol	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:0010008	endosome membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0019003	GDP binding	IDA	molecular function
GO:0005829	cytosol	IDA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0005769	early endosome	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0010008	endosome membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0098559	cytoplasmic side of early endosome membrane	IMP	cellular component
GO:0045022	early endosome to late endosome transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051036	regulation of endosome size	IMP	biological process
GO:0045921	positive regulation of exocytosis	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa04014	Ras signaling pathway
hsa05132	Salmonella infection
hsa05152	Tuberculosis
hsa04145	Phagosome
hsa05146	Amoebiasis
hsa05014	Amyotrophic lateral sclerosis
hsa04962	Vasopressin-regulated water reabsorption

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)