• Gene id: 5866

Gene Summary

• Gene Symbol: RAB3IL1   Gene   UCSC   Ensembl
• Aliases: GRAB
• Gene name: RAB3A interacting protein like 1
• Alternate names: guanine nucleotide exchange factor for Rab-3A, RAB3A interacting protein (rabin3)-like 1, rab3A-interacting-like protein 1, rabin3-like 1,
• Gene location: 11q12.2-q12.3 (61946311: 61897298)     Exons: 14     NC_000011.10
• Gene summary(Entrez): This gene encodes a guanine nucleotide exchange factor for the ras-related protein Rab3A. The encoded protein binds Rab3a and the inositol hexakisphosphate kinase InsP6K1. Alternative splicing results in multiple transcript variants. A related pseudogene
• OMIM: 600547

Protein Summary

• Protein general information: Q8TBN0  
  • Name: Guanine nucleotide exchange factor for Rab 3A (Rab 3A interacting like protein 1) (Rab3A interacting like protein 1) (Rabin3 like 1)
  • Length: 382  
  • Mass: 42637
• Sequence:

  MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLDVLRLRSSSMEIREKG
  SEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFEEAHKMVREANMKQAASEKQLKEARGKIDML
  QAEVTALKTLVITSTPASPNRELHPQLLSPTKAGPRKGHSRHKSTSSTLCPAVCPAAGHTLTPDREGKEVDTILF
  AEFQAWRESPTLDKTCPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEPVASQTLPTVKVAEVDCSSTN
  TCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQGLVRQDAEPMFWEIMRLRKEMSLAKL
  GFFPQEA

• Structural information:
  • Interpro: IPR040351  IPR009449  
  • PDB: 4LI0
  • PDBsum: 4LI0
  • STRING: ENSP00000378313
• Other Databases: GeneCards:  RAB3IL1  Malacards:  RAB3IL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0070319	Golgi to plasma membrane transport vesicle	IBA	cellular component
GO:0017112	Rab guanyl-nucleotide exchange factor activity	IBA	molecular function
GO:0006887	exocytosis	IBA	biological process
GO:0017112	Rab guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0015031	protein transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881