• Gene id: 5865

Gene Summary

• Gene Symbol: RAB3B   Gene   UCSC   Ensembl
• Gene name: RAB3B, member RAS oncogene family
• Alternate names: ras-related protein Rab-3B, brain antigen RAB3B,
• Gene location: 1p32.3 (51990699: 51907955)     Exons: 32     NC_000001.11
• OMIM: 179510

Protein Summary

• Protein general information: P20337  
  • Name: Ras related protein Rab 3B
  • Length: 219  
  • Mass: 24758
• Sequence:

  MASVTDGKTGVKDASDQNFDYMFKLLIIGNSSVGKTSFLFRYADDTFTPAFVSTVGIDFKVKTVYRHEKRVKLQI
  WDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWATQIKTYSWDNAQVILVGNKCDMEEERVVPTEKG
  QLLAEQLGFDFFEASAKENISVRQAFERLVDAICDKMSDSLDTDPSMLGSSKNTRLSDTPPLLQQNCSC

• Structural information:
  • Interpro: IPR027417  IPR037872  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd01865
  • PDB: 3DZ8
  • PDBsum: 3DZ8
  • STRING: ENSP00000360718
• Other Databases: GeneCards:  RAB3B  Malacards:  RAB3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0072659	protein localization to plasma membrane	IBA	biological process
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0017157	regulation of exocytosis	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0008021	synaptic vesicle	IBA	cellular component
GO:0005768	endosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0031982	vesicle	IBA	cellular component
GO:0009306	protein secretion	IBA	biological process
GO:0006904	vesicle docking involved in exocytosis	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IEA	cellular component
GO:0008021	synaptic vesicle	IEA	cellular component
GO:0017157	regulation of exocytosis	IEA	biological process
GO:0018125	peptidyl-cysteine methylation	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0030742	GTP-dependent protein binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0097494	regulation of vesicle size	IDA	biological process
GO:0019003	GDP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0051586	positive regulation of dopamine uptake involved in synaptic transmission	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0031982	vesicle	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0031489	myosin V binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019882	antigen processing and presentation	IMP	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:0098693	regulation of synaptic vesicle cycle	IMP	biological process
GO:0098693	regulation of synaptic vesicle cycle	IDA	biological process
GO:0098691	dopaminergic synapse	IMP	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IMP	cellular component
GO:0098691	dopaminergic synapse	IDA	cellular component
GO:0098993	anchored component of synaptic vesicle membrane	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq