• Gene id: 5863

Gene Summary

• Gene Symbol: RGL2   Gene   UCSC   Ensembl
• Aliases: HKE1.5, KE1.5, RAB2L
• Gene name: ral guanine nucleotide dissociation stimulator like 2
• Alternate names: ral guanine nucleotide dissociation stimulator-like 2, GDS-related protein, ralGDS-like 2, ralGDS-like factor, ras-associated protein RAB2L,
• Gene location: 6p21.32 (33299387: 33291653)     Exons: 18     NC_000006.12
• OMIM: 606816

Protein Summary

• Protein general information: O15211  
  • Name: Ral guanine nucleotide dissociation stimulator like 2 (RalGDS like 2) (RalGDS like factor) (Ras associated protein RAB2L)
  • Length: 777  
  • Mass: 83549
• Sequence:

  MLPRPLRLLLDTSPPGGVVLSSFRSRDPEEGGGPGGLVVGGGQEEEEEEEEEAPVSVWDEEEDGAVFTVTSRQYR
  PLDPLVPMPPPRSSRRLRAGTLEALVRHLLDTRTSGTDVSFMSAFLATHRAFTSTPALLGLMADRLEALESHPTD
  ELERTTEVAISVLSTWLASHPEDFGSEAKGQLDRLESFLLQTGYAAGKGVGGGSADLIRNLRSRVDPQAPDLPKP
  LALPGDPPADPTDVLVFLADHLAEQLTLLDAELFLNLIPSQCLGGLWGHRDRPGHSHLCPSVRATVTQFNKVAGA
  VVSSVLGATSTGEGPGEVTIRPLRPPQRARLLEKWIRVAEECRLLRNFSSVYAVVSALQSSPIHRLRAAWGEATR
  DSLRVFSSLCQIFSEEDNYSQSRELLVQEVKLQSPLEPHSKKAPRSGSRGGGVVPYLGTFLKDLVMLDAASKDEL
  ENGYINFDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLR
  PTLVISQWTEVLGSVGVPTPLVSCDRPSTGGDEAPTTPAPLLTRLAQHMKWPSVSSLDSALESSPSLHSPADPSH
  LSPPASSPRPSRGHRRSASCGSPLSGGAEEASGGTGYGGEGSGPGASDCRIIRVQMELGEDGSVYKSILVTSQDK
  APSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGVTSGPSAS
  GTPPSEGGGGSFPRIKATGRKIARALF

• Structural information:
  • Protein Domains: (88..21-)
    (/note="N-terminal-Ras-GEF)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00135-)
    (243..51-)
    (/note="Ras-GEF-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00168-)
    (648..73-)
    (/note="Ras-associating-)
    (/evidence="ECO:0000255|PROSIT-)
  • Interpro: IPR000159  IPR008937  IPR000651  IPR019804  IPR023578   IPR001895  IPR036964  IPR030749  IPR029071  
  • Prosite: PS50200 PS00720 PS50009 PS50212
  • CDD: cd00155 cd06224
  • STRING: ENSP00000420211
• Other Databases: GeneCards:  RGL2  Malacards:  RGL2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007165	signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010667	negative regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0032485	regulation of Ral protein signal transduction	IEA	biological process
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0007265	Ras protein signal transduction	NAS	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	NAS	molecular function
GO:0007165	signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0010667	negative regulation of cardiac muscle cell apoptotic process	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0032485	regulation of Ral protein signal transduction	IEA	biological process
GO:0005089	Rho guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005575	cellular_component	ND	cellular component
GO:0007265	Ras protein signal transduction	NAS	biological process
GO:0005088	Ras guanyl-nucleotide exchange factor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04014	Ras signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray