• Gene id: 5861

Gene Summary

• Gene Symbol: RAB1A   Gene   UCSC   Ensembl
• Aliases: RAB1, YPT1
• Gene name: RAB1A, member RAS oncogene family
• Alternate names: ras-related protein Rab-1A, GTP binding protein Rab1a, RAB1, member RAS oncogene family, Rab GTPase YPT1 homolog, YPT1-related protein,
• Gene location: 2p14 (65130300: 65086853)     Exons: 6     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl
• OMIM: 179508

Protein Summary

• Protein general information: P62820  
  • Name: Ras related protein Rab 1A (YPT1 related protein)
  • Length: 205  
  • Mass: 22678
• Sequence:

  MSSMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQIWDTAGQERFRT
  ITSSYYRGAHGIIVVYDVTDQESFNNVKQWLQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPF
  LETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGCC

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  
  • Prosite: PS51419
  • PDB: 2FOL 2WWX 3L0I 3SFV 3TKL 4FMB 4FMC 4FMD 4FME 4IRU 4JVS
  • PDBsum: 2FOL 2WWX 3L0I 3SFV 3TKL 4FMB 4FMC 4FMD 4FME 4IRU 4JVS
  • DIP: 1063
  • STRING: ENSP00000387286
• Other Databases: GeneCards:  RAB1A  Malacards:  RAB1A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003924	GTPase activity	IBA	molecular function
GO:0012505	endomembrane system	IBA	cellular component
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0000045	autophagosome assembly	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0003924	GTPase activity	IDA	molecular function
GO:0047496	vesicle transport along microtubule	IMP	biological process
GO:0016477	cell migration	IMP	biological process
GO:0072606	interleukin-8 secretion	IMP	biological process
GO:0042742	defense response to bacterium	IMP	biological process
GO:0030252	growth hormone secretion	IMP	biological process
GO:0006914	autophagy	IMP	biological process
GO:0006897	endocytosis	IMP	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000045	autophagosome assembly	IMP	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005768	endosome	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0006914	autophagy	IEA	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0016192	vesicle-mediated transport	TAS	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	TAS	biological process
GO:0006890	retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum	TAS	biological process
GO:0030658	transport vesicle membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0048208	COPII vesicle coating	TAS	biological process
GO:1904668	positive regulation of ubiquitin protein ligase activity	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032402	melanosome transport	IEA	biological process
GO:0016477	cell migration	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0045296	cadherin binding	HDA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0003924	GTPase activity	IDA	molecular function
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	biological process
GO:0019068	virion assembly	IMP	biological process
GO:0007030	Golgi organization	IMP	biological process
GO:0090557	establishment of endothelial intestinal barrier	IMP	NOT|biological process
GO:0090110	COPII-coated vesicle cargo loading	IMP	biological process
GO:0060271	cilium assembly	IMP	NOT|biological process
GO:0005515	protein binding	IPI	molecular function
GO:1903020	positive regulation of glycoprotein metabolic process	IGI	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IGI	biological process
GO:0019068	virion assembly	IGI	biological process
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0005794	Golgi apparatus	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05130	Pathogenic Escherichia coli infection
hsa04140	Autophagy - animal
hsa05134	Legionellosis

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881