• Gene id: 58530

Gene Summary

• Gene Symbol: LY6G6D   Gene   UCSC   Ensembl
• Aliases: C6orf23, G6D, LY6-D, MEGT1, NG25
• Gene name: lymphocyte antigen 6 family member G6D
• Alternate names: lymphocyte antigen 6 complex locus protein G6d, lymphocyte antigen 6 complex, locus G6D, lymphocyte antigen-6 G6D, megakaryocyte-enhanced gene transcript 1 protein, protein Ly6-D,
• Gene location: 6p21.33 (31715355: 31717803)     Exons: 3     NC_000006.12
• Gene summary(Entrez): LY6G6D belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
• OMIM: 606038

Protein Summary

• Protein general information: O95868  
  • Name: Lymphocyte antigen 6 complex locus protein G6d (Protein Ly6 D) (Megakaryocyte enhanced gene transcript 1 protein)
  • Length: 133  
  • Mass: 13691
  • Tissue specificity: Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen. {ECO
• Sequence:

  MKPQFVGILLSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAH
  HCNQVETESVGDVTYPAHRDCYLGDLCNSAVASHVAPAGILAAAATALTCLLPGLWSG

• Structural information:
  • Protein Domains: (22..11-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR026524  
  • STRING: ENSP00000364985
• Other Databases: GeneCards:  LY6G6D  Malacards:  LY6G6D

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042995	cell projection	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0031225	anchored component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0032991	protein-containing complex	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0030550	acetylcholine receptor inhibitor activity	IEA	molecular function
GO:0042802	identical protein binding	IEA	molecular function
GO:0095500	acetylcholine receptor signaling pathway	IEA	biological process
GO:0030175	filopodium	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:2000272	negative regulation of signaling receptor activity	IEA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	colocalizes with
GO:0042802	identical protein binding	IDA	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)