• Gene id: 58528

Gene Summary

• Gene Symbol: RRAGD   Gene   UCSC   Ensembl
• Aliases: RAGD, bA11D8.2.1
• Gene name: Ras related GTP binding D
• Alternate names: ras-related GTP-binding protein D, Rag D protein,
• Gene location: 6q15 (89412272: 89363508)     Exons: 8     NC_000006.12
• Gene summary(Entrez): RRAGD is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.[supplied by OMIM, Apr 2004]
• OMIM: 608268

Protein Summary

• Protein general information: Q9NQL2  
  • Name: Ras related GTP binding protein D (Rag D) (RagD) (EC 3.6.5. )
  • Length: 400  
  • Mass: 45588
• Sequence:

  MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVKPRILLMGLRRSGK
  SSIQKVVFHKMSPNETLFLESTNKICREDVSNSSFVNFQIWDFPGQIDFFDPTFDYEMIFRGTGALIFVIDSQDD
  YMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHLSFYLTSIYDHS
  IFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIY
  GLKEDGAGTPYDKESTAIIKLNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCFRKAIHEVFEVRMKVV
  KSRKVQNRLQKKKRATPNGTPRVLL

• Structural information:
  • Interpro: IPR006762  IPR027417  IPR039400  
  • CDD: cd11385
  • PDB: 2Q3F
  • PDBsum: 2Q3F
  • STRING: ENSP00000358423
• Other Databases: GeneCards:  RRAGD  Malacards:  RRAGD

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0009267	cellular response to starvation	IBA	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005764	lysosome	IBA	cellular component
GO:0010506	regulation of autophagy	IBA	biological process
GO:0032008	positive regulation of TOR signaling	IBA	biological process
GO:0034448	EGO complex	IBA	cellular component
GO:0071230	cellular response to amino acid stimulus	IBA	biological process
GO:1990131	Gtr1-Gtr2 GTPase complex	IBA	cellular component
GO:0005764	lysosome	IDA	cellular component
GO:0071230	cellular response to amino acid stimulus	ISS	biological process
GO:0032008	positive regulation of TOR signaling	NAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0034613	cellular protein localization	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0007050	cell cycle arrest	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0016241	regulation of macroautophagy	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005813	centrosome	IDA	cellular component
GO:1990253	cellular response to leucine starvation	IMP	biological process
GO:1904263	positive regulation of TORC1 signaling	IMP	biological process
GO:0003924	GTPase activity	IMP	molecular function
GO:0005525	GTP binding	IMP	molecular function
GO:0071233	cellular response to leucine	IMP	biological process
GO:0051020	GTPase binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0019003	GDP binding	IMP	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis
hsa04150	mTOR signaling pathway
hsa04140	Autophagy - animal

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray