• Gene id: 58526

Gene Summary

• Gene Symbol: MID1IP1   Gene   UCSC   Ensembl
• Aliases: G12-like, MIG12, S14R, STRAIT11499, THRSPL
• Gene name: MID1 interacting protein 1
• Alternate names: mid1-interacting protein 1, MID1 interacting G12-like protein, MID1 interacting protein 1 (gastrulation specific G12-like), gastrulation specific G12 homolog, spot 14-R, spot 14-related protein,
• Gene location: Xp11.4 (27484419: 27372720)     Exons: 28     NC_000003.12
• OMIM: 300961

Protein Summary

• Protein general information: Q9NPA3  
  • Name: Mid1 interacting protein 1 (Gastrulation specific G12 like protein) (Mid1 interacting G12 like protein) (Protein STRAIT11499) (Spot 14 related protein) (S14R) (Spot 14 R)
  • Length: 183  
  • Mass: 20202
• Sequence:

  MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPVPDSGS
  ANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGEEDLEQQFHYH
  LRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH

• Structural information:
  • Interpro: IPR009786  
  • STRING: ENSP00000483547
• Other Databases: GeneCards:  MID1IP1  Malacards:  MID1IP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IBA	cellular component
GO:0046890	regulation of lipid biosynthetic process	IBA	biological process
GO:0051351	positive regulation of ligase activity	ISS	biological process
GO:0045723	positive regulation of fatty acid biosynthetic process	ISS	biological process
GO:0005829	cytosol	ISS	cellular component
GO:0051258	protein polymerization	ISS	biological process
GO:0046890	regulation of lipid biosynthetic process	ISS	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0006853	carnitine shuttle	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0008022	protein C-terminus binding	IEA	molecular function
GO:0015630	microtubule cytoskeleton	IEA	cellular component
GO:0045723	positive regulation of fatty acid biosynthetic process	IEA	biological process
GO:0051351	positive regulation of ligase activity	IEA	biological process
GO:0046890	regulation of lipid biosynthetic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007026	negative regulation of microtubule depolymerization	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0051258	protein polymerization	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0015630	microtubule cytoskeleton	ISS	cellular component
GO:0007026	negative regulation of microtubule depolymerization	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)