• Gene id: 58516

Gene Summary

• Gene Symbol: SINHCAF   Gene   UCSC   Ensembl
• Aliases: C12orf14, FAM60A, L4, TERA
• Gene name: SIN3-HDAC complex associated factor
• Alternate names: SIN3-HDAC complex-associated factor, family with sequence similarity 60 member A, protein FAM60A, tera protein homolog,
• Gene location: 12p11.21 (31326217: 31280583)     Exons: 10     NC_000012.12
• OMIM: 615027

Protein Summary

• Protein general information: Q9NP50  
  • Name: SIN3 HDAC complex associated factor (Protein FAM60A) (Tera protein homolog)
  • Length: 221  
  • Mass: 24852
• Sequence:

  MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLVKRWKKLPAGSKKNWN
  HVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNSDAHSTTSSASPAQSPCYSNQSDDGSDTEMA
  SGSNRTPVFSFLDLTYWKRQKICCGIIYKGRFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

• Structural information:
  • Interpro: IPR026065  
  • STRING: ENSP00000337477
• Other Databases: GeneCards:  SINHCAF  Malacards:  SINHCAF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016580	Sin3 complex	IBA	cellular component
GO:0030336	negative regulation of cell migration	IBA	biological process
GO:0016580	Sin3 complex	IDA	cellular component
GO:0045596	negative regulation of cell differentiation	ISS	biological process
GO:0008284	positive regulation of cell population proliferation	ISS	biological process
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045596	negative regulation of cell differentiation	IEA	biological process
GO:0008284	positive regulation of cell population proliferation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R