• Gene id: 58510

Gene Summary

• Gene Symbol: PRODH2   Gene   UCSC   Ensembl
• Aliases: HSPOX1, HYPDH
• Gene name: proline dehydrogenase 2
• Alternate names: hydroxyproline dehydrogenase, kidney and liver proline oxidase 1, probable proline dehydrogenase 2, probable proline oxidase 2, proline dehydrogenase (oxidase) 2,
• Gene location: 19q13.12 (35813298: 35799987)     Exons: 11     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene catalyzes the first step in the catabolism of trans-4-hydroxy-L-proline, an amino acid derivative obtained through food intake and collagen turnover. One of the downstream products of this catabolism is glyoxylate, which i
• OMIM: 616377

Protein Summary

• Protein general information: Q9UF12  
  • Name: Hydroxyproline dehydrogenase (HYPDH) (EC 1.5.5.3) (Kidney and liver proline oxidase 1) (HsPOX1) (Probable proline dehydrogenase 2) (EC 1.5.5.2) (Probable proline oxidase 2)
  • Length: 536  
  • Mass: 58871
• Sequence:

  MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNLLPPENLPWCGGSQGP
  RMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVLRLCAWPPLVTHGLLLQAWSRRLLGSRLSGA
  FLRASVYGQFVAGETAEEVKGCVQQLRTLSLRPLLAVPTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPP
  SLAEASLMQLKVTALTSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRV
  AQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERLGRDAEAAHRAGLAFG
  VKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLTHVARHGPMCHLMVASHNEESVRQATKRMWE
  LGIPLDGTVCFGQLLGMCDHVSLALGQAGYVVYKSIPYGSLEEVIPYLIRRAQENRSVLQGARREQELLSQELWR
  RLLPGCRRIPH

• Structural information:
  • Interpro: IPR029041  IPR002872  IPR015659  
  • STRING: ENSP00000301175
• Other Databases: GeneCards:  PRODH2  Malacards:  PRODH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004657	proline dehydrogenase activity	IBA	molecular function
GO:0005739	mitochondrion	IBA	cellular component
GO:0010133	proline catabolic process to glutamate	IBA	biological process
GO:0071949	FAD binding	IBA	molecular function
GO:0016645	oxidoreductase activity, acting on the CH-NH group of donors	IDA	molecular function
GO:0004657	proline dehydrogenase activity	IEA	molecular function
GO:0006562	proline catabolic process	IEA	biological process
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0006560	proline metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0004657	proline dehydrogenase activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006562	proline catabolic process	TAS	biological process
GO:0046487	glyoxylate metabolic process	TAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00330	Arginine and proline metabolism

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)