• Gene id: 58505

Gene Summary

• Gene Symbol: OSTC   Gene   UCSC   Ensembl
• Aliases: DC2
• Gene name: oligosaccharyltransferase complex non-catalytic subunit
• Alternate names: oligosaccharyltransferase complex subunit OSTC, hydrophobic protein HSF-28, oligosaccharyltransferase complex subunit (non-catalytic),
• Gene location: 4q25 (108650584: 108667821)     Exons: 5     NC_000004.12
• OMIM: 0

Protein Summary

• Protein general information: Q9NRP0  
  • Name: Oligosaccharyltransferase complex subunit OSTC (Hydrophobic protein HSF 28)
  • Length: 149  
  • Mass: 16829
• Sequence:

  METLYRVPFLVLECPNLKLKKPPWLHMPSAMTVYALVVVSYFLITGGIIYDVIVEPPSVGSMTDEHGHQRPVAFL
  AYRVNGQYIMEGLASSFLFTMGGLGFIILDRSNAPNIPKLNRFLLLFIGFVCVLLSFFMARVFMRMKLPGYLMG

• Structural information:
  • Interpro: IPR021149  IPR042416  
  • PDB: 6S7O
  • PDBsum: 6S7O
  • STRING: ENSP00000426167
• Other Databases: GeneCards:  OSTC  Malacards:  OSTC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004579	dolichyl-diphosphooligosaccharide-protein glycotransferase activity	IC	contributes to
GO:0018279	protein N-linked glycosylation via asparagine	IC	biological process
GO:0008250	oligosaccharyltransferase complex	IBA	cellular component
GO:0006486	protein glycosylation	IEA	biological process
GO:0008250	oligosaccharyltransferase complex	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008250	oligosaccharyltransferase complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006486	protein glycosylation	IEA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)