• Gene id: 58496

Gene Summary

• Gene Symbol: LY6G5B   Gene   UCSC   Ensembl
• Aliases: C6orf19, G5b
• Gene name: lymphocyte antigen 6 family member G5B
• Alternate names: lymphocyte antigen 6 complex locus protein G5b, lymphocyte antigen 6 complex, locus G5B, lymphocyte antigen-6 G5B splicing isoform 288, lymphocyte antigen-6 G5B splicing isoform 452, lymphocyte antigen-6 G5B splicing isoform 690, lymphocyte antigen-6 G5B splic,
• Gene location: 6p21.33 (31670950: 31672449)     Exons: 3     NC_000006.12
• Gene summary(Entrez): LY6G5B belongs to a cluster of leukocyte antigen-6 (LY6) genes located in the major histocompatibility complex (MHC) class III region on chromosome 6. Members of the LY6 superfamily typically contain 70 to 80 amino acids, including 8 to 10 cysteines. Most
• OMIM: 610433

Protein Summary

• Protein general information: Q8NDX9  
  • Name: Lymphocyte antigen 6 complex locus protein G5b
  • Length: 201  
  • Mass: 22572
• Sequence:

  MKVHMLVGVLVMVGFTVGKVPVPDIRTCHFCLVEDPSVGCISGSEKCTISSSSLCMVITIYYDVKVRFIVRGCGQ
  YISYRCQEKRNTYFAEYWYQAQCCQYDYCNSWSSPQLQSSLPEPHDRPLALPLSDSQIQWFYQALNLSLPLPNFH
  AGTEPDGLDPMVTLSLNLGLSFAELRRMYLFLNSSGLLVLPQAGLLTPHPS

• Structural information:
  • Protein Domains: (26..11-)
    (/note="UPAR/Ly6"-)
  • Interpro: IPR038773  
  • STRING: ENSP00000365024
• Other Databases: GeneCards:  LY6G5B  Malacards:  LY6G5B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0009897	external side of plasma membrane	IBA	colocalizes with
GO:0005576	extracellular region	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0042802	identical protein binding	IDA	molecular function
GO:0009897	external side of plasma membrane	IDA	colocalizes with
GO:0032991	protein-containing complex	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)