• Gene id: 58493

Gene Summary

• Gene Symbol: INIP   Gene   UCSC   Ensembl
• Aliases: C9orf80, HSPC043, MISE, SOSSC, SSBIP1, hSSBIP1
• Gene name: INTS3 and NABP interacting protein
• Alternate names: SOSS complex subunit C, SSB-interacting protein 1, hSSB-interacting protein 1, minute INTS3/hSSB-associated element, sensor of single-strand DNA complex subunit C, sensor of ssDNA subunit C, single-stranded DNA-binding protein-interacting protein 1,
• Gene location: 9q32 (112718116: 112683925)     Exons: 7     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene is a subunit of single-stranded DNA binding complexes that are important for maintaining genome stability. These complexes are involved in G2/M checkpoint control and homologous recombination repair. [provided by RefSeq, J
• OMIM: 613273

Protein Summary

• Protein general information: Q9NRY2  
  • Name: SOSS complex subunit C (INTS3 and NABP interacting protein) (Sensor of single strand DNA complex subunit C) (Sensor of ssDNA subunit C) (SOSS C) (Single stranded DNA binding protein interacting protein 1) (SSB interacting protein 1) (hSSBIP1)
  • Length: 104  
  • Mass: 11425
• Sequence:

  MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKAALQHA
  HAHSSGYFITQDSAFGNLILPVLPRLDPE

• Structural information:
  • Interpro: IPR031821  
  • PDB: 4OWT 4OWW
  • PDBsum: 4OWT 4OWW
  • STRING: ENSP00000363360
• Other Databases: GeneCards:  INIP  Malacards:  INIP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005654	nucleoplasm	IBA	cellular component
GO:0006281	DNA repair	IBA	biological process
GO:0070876	SOSS complex	IBA	cellular component
GO:0070876	SOSS complex	IDA	cellular component
GO:0070876	SOSS complex	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0006281	DNA repair	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0010212	response to ionizing radiation	IMP	biological process
GO:0006974	cellular response to DNA damage stimulus	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0006281	DNA repair	IEA	biological process
GO:0070876	SOSS complex	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006281	DNA repair	IEA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)