• Gene id: 58490

Gene Summary

• Gene Symbol: RPRD1B   Gene   UCSC   Ensembl
• Aliases: C20orf77, CREPT, K-H, Kub5-Hera, NET60, dJ1057B20.2
• Gene name: regulation of nuclear pre-mRNA domain containing 1B
• Alternate names: regulation of nuclear pre-mRNA domain-containing protein 1B, Ku70-binding protein 5-Hera, cell-cycle related and expression-elevated protein in tumor,
• Gene location: 20q11.23 (38033461: 38092365)     Exons: 10     NC_000020.11
• OMIM: 606247

Protein Summary

• Protein general information: Q9NQG5  
  • Name: Regulation of nuclear pre mRNA domain containing protein 1B (Cell cycle related and expression elevated protein in tumor)
  • Length: 326  
  • Mass: 36900
  • Tissue specificity: Preferentially expressed in a range of tumor tissues including colon, lung, liver, breast, prostate, stomach, uterine endometrium and cervical cancers with higher levels in tumors than in adjacent non-tumor tissue (at protein level). {
• Sequence:

  MSSFSESALEKKLSELSNSQQSVQTLSLWLIHHRKHAGPIVSVWHRELRKAKSNRKLTFLYLANDVIQNSKRKGP
  EFTREFESVLVDAFSHVAREADEGCKKPLERLLNIWQERSVYGGEFIQQLKLSMEDSKSPPPKATEEKKSLKRTF
  QQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLLEKITDKEAAER
  LSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDVLSEKEKKLEEYKQKLARVTQVRKELKSHIQSL
  PDLSLLPNVTGGLAPLPSAGDLFSTD

• Structural information:
  • Protein Domains: (2..13-)
    (/note="CID-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00724"-)
  • Interpro: IPR006569  IPR032337  IPR008942  IPR006903  
  • Prosite: PS51391
  • PDB: 4FLA 4FU3 4HFG 4NAD 4Q94 4Q96
  • PDBsum: 4FLA 4FU3 4HFG 4NAD 4Q94 4Q96
  • DIP: 61537
  • STRING: ENSP00000362532
• Other Databases: GeneCards:  RPRD1B  Malacards:  RPRD1B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016591	RNA polymerase II, holoenzyme	IBA	cellular component
GO:0031124	mRNA 3'-end processing	IBA	biological process
GO:0000993	RNA polymerase II complex binding	IBA	molecular function
GO:0016591	RNA polymerase II, holoenzyme	IDA	cellular component
GO:0070940	dephosphorylation of RNA polymerase II C-terminal domain	IMP	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0042795	snRNA transcription by RNA polymerase II	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0010564	regulation of cell cycle process	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0000993	RNA polymerase II complex binding	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq