• Gene id: 58488

Gene Summary

• Gene Symbol: PCTP   Gene   UCSC   Ensembl
• Aliases: PC-TP, STARD2
• Gene name: phosphatidylcholine transfer protein
• Alternate names: phosphatidylcholine transfer protein, START domain-containing protein 2, StAR-related lipid transfer (START) domain containing 2, stAR-related lipid transfer protein 2,
• Gene location: 17q22 (55750978: 55845000)     Exons: 8     NC_000017.11
• OMIM: 606055

Protein Summary

• Protein general information: Q9UKL6  
  • Name: Phosphatidylcholine transfer protein (PC TP) (START domain containing protein 2) (StARD2) (StAR related lipid transfer protein 2)
  • Length: 214  
  • Mass: 24843
  • Tissue specificity: Highest expression in liver, placenta, testis, kidney and heart. Low levels in brain and lung. No expression detected in thymus. {ECO
• Sequence:

  MELAAGSFSEEQFWEACAELQQPALAGADWQLLVETSGISIYRLLDKKTGLYEYKVFGVLEDCSPTLLADIYMDS
  DYRKQWDQYVKELYEQECNGETVVYWEVKYPFPMSNRDYVYLRQRRDLDMEGRKIHVILARSTSMPQLGERSGVI
  RVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWAAKNGVPNFLKDMARACQNYLKKT

• Structural information:
  • Protein Domains: (1..21-)
    (/note="START-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00197"-)
  • Interpro: IPR041950  IPR023393  IPR002913  
  • Prosite: PS50848
  • CDD: cd08910
  • PDB: 1LN1 1LN2 1LN3
  • PDBsum: 1LN1 1LN2 1LN3
  • STRING: ENSP00000268896
• Other Databases: GeneCards:  PCTP  Malacards:  PCTP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031210	phosphatidylcholine binding	IBA	molecular function
GO:0008525	phosphatidylcholine transporter activity	IBA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0008289	lipid binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0006869	lipid transport	IEA	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0006656	phosphatidylcholine biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0031210	phosphatidylcholine binding	IDA	molecular function
GO:0008525	phosphatidylcholine transporter activity	IDA	molecular function
GO:0015914	phospholipid transport	IDA	biological process
GO:0008525	phosphatidylcholine transporter activity	TAS	molecular function
GO:0008525	phosphatidylcholine transporter activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	NAS	cellular component
GO:0006869	lipid transport	NAS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)