• Gene id: 58487

Gene Summary

• Gene Symbol: CREBZF   Gene   UCSC   Ensembl
• Aliases: SMILE, ZF
• Gene name: CREB/ATF bZIP transcription factor
• Alternate names: CREB/ATF bZIP transcription factor, HCF-binding transcription factor Zhangfei, SHP-interacting leucine zipper protein, Zhangfei, host cell factor-binding transcription factor Zhangfei,
• Gene location: 11q14.1 (85682862: 85657984)     Exons: 8     NC_000011.10
• OMIM: 606444

Protein Summary

• Protein general information: Q9NS37  
  • Name: CREB/ATF bZIP transcription factor (Host cell factor binding transcription factor Zhangfei) (HCF binding transcription factor Zhangfei)
  • Length: 354  
  • Mass: 37134
  • Tissue specificity: In adults, expressed most abundantly in heart, liver and skeletal muscle, moderately abundant in kidney and pancreas, and barely detectable in lung. In fetal tissues, expressed most abundantly in kidney and very low amounts in heart, l
• Sequence:

  MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSRGGVAV
  RAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSGGLWRGDDDDE
  AAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSPRKAAAAAARLNRLKK
  KEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARLLSRLSGVGLRLTTSLFRDSP
  AGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSLKM

• Structural information:
  • Protein Domains: (204..26-)
    (/note="bZIP"-)
  • Interpro: IPR004827  
  • DIP: 33934
  • STRING: ENSP00000433459
• Other Databases: GeneCards:  CREBZF  Malacards:  CREBZF

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISM	molecular function
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0051090	regulation of DNA-binding transcription factor activity	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006355	regulation of transcription, DNA-templated	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0051090	regulation of DNA-binding transcription factor activity	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0009615	response to virus	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IMP	biological process
GO:0045814	negative regulation of gene expression, epigenetic	IEP	biological process
GO:0003677	DNA binding	NAS	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)