• Gene id: 58485

Gene Summary

• Gene Symbol: TRAPPC1   Gene   UCSC   Ensembl
• Aliases: BET5, MUM2
• Gene name: trafficking protein particle complex 1
• Alternate names: trafficking protein particle complex subunit 1, BET5 homolog, MUM-2, melanoma ubiquitous mutated 2, multiple myeloma protein 2,
• Gene location: 17p13.1 (7931998: 7930344)     Exons: 4     NC_000017.11
• Gene summary(Entrez): This gene product plays a role in vesicular transport of proteins to the Golgi apparatus from the endoplasmic reticulum. The encoded protein is a component of the multisubunit transport protein particle (TRAPP) complex. Alternative splicing results in mul
• OMIM: 164761

Protein Summary

• Protein general information: Q9Y5R8  
  • Name: Trafficking protein particle complex subunit 1 (BET5 homolog) (Multiple myeloma protein 2) (MUM 2)
  • Length: 145  
  • Mass: 16832
• Sequence:

  MTVHNLYLFDRNGVCLHYSEWHRKKQAGIPKEEEYKLMYGMLFSIRSFVSKMSPLDMKDGFLAFQTSRYKLHYYE
  TPTGIKVVMNTDLGVGPIRDVLHHIYSALYVELVVKNPLCPLGQTVQSELFRSRLDSYVRSLPFFSARAG

• Structural information:
  • Interpro: IPR011012  IPR007233  
  • DIP: 48285
  • STRING: ENSP00000302783
• Other Databases: GeneCards:  TRAPPC1  Malacards:  TRAPPC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006888	endoplasmic reticulum to Golgi vesicle-mediated transport	IBA	biological process
GO:0030008	TRAPP complex	IBA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0030008	TRAPP complex	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0035578	azurophil granule lumen	TAS	cellular component
GO:0048208	COPII vesicle coating	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030008	TRAPP complex	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881