• Gene id: 58480

Gene Summary

• Gene Symbol: RHOU   Gene   UCSC   Ensembl
• Aliases: ARHU, CDC42L1, G28K, WRCH1, hG28K
• Gene name: ras homolog family member U
• Alternate names: rho-related GTP-binding protein RhoU, 2310026M05Rik, CDC42-like GTPase 1, GTP-binding protein SB128, GTP-binding protein like 1, Ryu GTPase, ras homolog gene family, member U, ras-like gene family member U, rho GTPase-like protein ARHU, wnt-1 responsive Cdc42 homo,
• Gene location: 1q42.13 (228644646: 228746668)     Exons: 4     NC_000001.11
• Gene summary(Entrez): This gene encodes a member of the Rho family of GTPases. This protein can activate PAK1 and JNK1, and can induce filopodium formation and stress fiber dissolution. It may also mediate the effects of WNT1 signaling in the regulation of cell morphology, cyt
• OMIM: 606366

Protein Summary

• Protein general information: Q7L0Q8  
  • Name: Rho related GTP binding protein RhoU (CDC42 like GTPase 1) (GTP binding protein like 1) (Rho GTPase like protein ARHU) (Ryu GTPase) (Wnt 1 responsive Cdc42 homolog 1) (WRCH 1)
  • Length: 258  
  • Mass: 28218
  • Tissue specificity: Ubiquitously expressed in all tissues examined. Expressed at high levels in the stomach, small intestine, brain, skeletal muscle and placenta. {ECO
• Sequence:

  MPPQQGDPAFPDRCEAPPVPPRRERGGRGGRGPGEPGGRGRAGGAEGRGVKCVLVGDGAVGKTSLVVSYTTNGYP
  TEYIPTAFDNFSAVVSVDGRPVRLQLCDTAGQDEFDKLRPLCYTNTDIFLLCFSVVSPSSFQNVSEKWVPEIRCH
  CPKAPIILVGTQSDLREDVKVLIELDKCKEKPVPEEAAKLCAEEIKAASYIECSALTQKNLKEVFDAAIVAGIQY
  SDTQQQPKKSKSRTPDKMKNLSKSWWKKYCCFV

• Structural information:
  • Interpro: IPR027417  IPR005225  IPR001806  IPR003578  
  • Prosite: PS51420
  • PDB: 2Q3H
  • PDBsum: 2Q3H
  • STRING: ENSP00000355652
• Other Databases: GeneCards:  RHOU  Malacards:  RHOU

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1903955	positive regulation of protein targeting to mitochondrion	HMP	biological process
GO:0003924	GTPase activity	IBA	molecular function
GO:0005525	GTP binding	IBA	molecular function
GO:0005938	cell cortex	IBA	cellular component
GO:0007015	actin filament organization	IBA	biological process
GO:0008360	regulation of cell shape	IBA	biological process
GO:0016477	cell migration	IBA	biological process
GO:0030031	cell projection assembly	IBA	biological process
GO:0030036	actin cytoskeleton organization	IBA	biological process
GO:0030865	cortical cytoskeleton organization	IBA	biological process
GO:0031410	cytoplasmic vesicle	IBA	cellular component
GO:0032488	Cdc42 protein signal transduction	IBA	biological process
GO:0042995	cell projection	IBA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0005856	cytoskeleton	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0006897	endocytosis	IBA	biological process
GO:0007163	establishment or maintenance of cell polarity	IBA	biological process
GO:0019901	protein kinase binding	IBA	molecular function
GO:0032956	regulation of actin cytoskeleton organization	IBA	biological process
GO:0008360	regulation of cell shape	IMP	biological process
GO:0007010	cytoskeleton organization	IMP	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0007264	small GTPase mediated signal transduction	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0019221	cytokine-mediated signaling pathway	TAS	biological process
GO:0051056	regulation of small GTPase mediated signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030036	actin cytoskeleton organization	IEA	biological process
GO:0016601	Rac protein signal transduction	IEA	biological process
GO:0008360	regulation of cell shape	IEA	biological process
GO:0003924	GTPase activity	IEA	molecular function
GO:0000082	G1/S transition of mitotic cell cycle	IEA	biological process
GO:0002102	podosome	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R