• Gene id: 58477

Gene Summary

• Gene Symbol: SRPRB   Gene   UCSC   Ensembl
• Aliases: APMCF1, SR-beta
• Gene name: SRP receptor subunit beta
• Alternate names: signal recognition particle receptor subunit beta, SRP receptor beta subunit, signal recognition particle receptor, B subunit, signal recognition particle receptor, beta subunit,
• Gene location: 3q22.1 (133784022: 133828573)     Exons: 9     NC_000003.12
• Gene summary(Entrez): The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membra
• OMIM: 616883

Protein Summary

• Protein general information: Q9Y5M8  
  • Name: Signal recognition particle receptor subunit beta (SR beta) (Protein APMCF1)
  • Length: 271  
  • Mass: 29702
• Sequence:

  MASADSRRVADGGGAGGTFQPYLDTLRQELQQTDPTLLSVVVAVLAVLLTLVFWKLIRSRRSSQRAVLLVGLCDS
  GKTLLFVRLLTGLYRDTQTSITDSCAVYRVNNNRGNSLTLIDLPGHESLRLQFLERFKSSARAIVFVVDSAAFQR
  EVKDVAEFLYQVLIDSMGLKNTPSFLIACNKQDIAMAKSAKLIQQQLEKELNTLRVTRSAAPSTLDSSSTAPAQL
  GKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADIQDLEKWLAKIA

• Structural information:
  • Interpro: IPR027417  IPR019009  
  • CDD: cd04105
  • DIP: 50218
  • STRING: ENSP00000418401
• Other Databases: GeneCards:  SRPRB  Malacards:  SRPRB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005881	cytoplasmic microtubule	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005525	GTP binding	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0036498	IRE1-mediated unfolded protein response	TAS	biological process
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0005737	cytoplasm	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03060	Protein export

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq