• Gene id: 58475

Gene Summary

• Gene Symbol: MS4A7   Gene   UCSC   Ensembl
• Aliases: 4SPAN2, CD20L4, CFFM4, MS4A8
• Gene name: membrane spanning 4-domains A7
• Alternate names: membrane-spanning 4-domains subfamily A member 7, CD20 antigen-like 4, CD20/Fc-epsilon-RI-beta family member 4, four-span transmembrane protein 2, high affinity immunoglobulin epsilon receptor beta subunit,
• Gene location: 11q12.2 (60378484: 60395953)     Exons: 7     NC_000011.10
• Gene summary(Entrez): This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid ti
• OMIM: 606001

Protein Summary

• Protein general information: Q9GZW8  
  • Name: Membrane spanning 4 domains subfamily A member 7 (CD20 antigen like 4) (CD20/FC epsilon RI beta family member 4) (Four span transmembrane protein 2)
  • Length: 240  
  • Mass: 26131
  • Tissue specificity: Ubiquitous expression in normal tissues. Expression is more elevated in adult liver, lung, spleen, and heart than in their fetal counterparts, and is higher in normal tissues than in the cancerous tissue or cell lines. Low levels of ex
• Sequence:

  MLLQSQTMGVSHSFTPKGITIPQREKPGHMYQNEDYLQNGLPTETTVLGTVQILCCLLISSLGAILVFAPYPSHF
  NPAISTTLMSGYPFLGALCFGITGSLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCG
  SEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAAYSSVFWWKQLYSNNPGSSFSSTQSQ
  DHIQQVKKSSSRSWI

• Structural information:
  • Interpro: IPR007237  IPR030417  IPR030423  
  • STRING: ENSP00000300184
• Other Databases: GeneCards:  MS4A7  Malacards:  MS4A7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R