• Gene id: 58472

Gene Summary

• Gene Symbol: SQOR   Gene   UCSC   Ensembl
• Aliases: CGI-44, PRO1975, SQR, SQRDL
• Gene name: sulfide quinone oxidoreductase
• Alternate names: sulfide:quinone oxidoreductase, mitochondrial, sulfide dehydrogenase like, sulfide quinone reductase-like,
• Gene location: 15q21.1 (45631147: 45691293)     Exons: 12     NC_000015.10
• Gene summary(Entrez): The protein encoded by this gene may function in mitochondria to catalyze the conversion of sulfide to persulfides, thereby decreasing toxic concencrations of sulfide. Alternative splicing results in multiple transcript variants that encode the same prote
• OMIM: 603245

Protein Summary

• Protein general information: Q9Y6N5  
  • Name: Sulfide:quinone oxidoreductase, mitochondrial (SQOR) (EC 1.8.5.8) (Sulfide dehydrogenase like) (Sulfide quinone oxidoreductase)
  • Length: 450  
  • Mass: 49961
• Sequence:

  MVPLVAVVSGPRAQLFACLLRLGTQQVGPLQLHTGASHAARNHYEVLVLGGGSGGITMAARMKRKVGAENVAIVE
  PSERHFYQPIWTLVGAGAKQLSSSGRPTASVIPSGVEWIKARVTELNPDKNCIHTDDDEKISYRYLIIALGIQLD
  YEKIKGLPEGFAHPKIGSNYSVKTVEKTWKALQDFKEGNAIFTFPNTPVKCAGAPQKIMYLSEAYFRKTGKRSKA
  NIIFNTSLGAIFGVKKYADALQEIIQERNLTVNYKKNLIEVRADKQEAVFENLDKPGETQVISYEMLHVTPPMSP
  PDVLKTSPVADAAGWVDVDKETLQHRRYPNVFGIGDCTNLPTSKTAAAVAAQSGILDRTISVIMKNQTPTKKYDG
  YTSCPLVTGYNRVILAEFDYKAEPLETFPFDQSKERLSMYLMKADLMPFLYWNMMLRGYWGGPAFLRKLFHLGMS

• Structural information:
  • Interpro: IPR036188  IPR023753  IPR015904  
  • PDB: 6MO6 6MP5 6OI5 6OI6 6OIB 6OIC
  • PDBsum: 6MO6 6MP5 6OI5 6OI6 6OIB 6OIC
  • STRING: ENSP00000260324
• Other Databases: GeneCards:  SQOR  Malacards:  SQOR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005739	mitochondrion	IBA	cellular component
GO:0070221	sulfide oxidation, using sulfide:quinone oxidoreductase	IBA	biological process
GO:0070224	sulfide:quinone oxidoreductase activity	IBA	molecular function
GO:0071949	FAD binding	IBA	molecular function
GO:0070813	hydrogen sulfide metabolic process	IDA	biological process
GO:0070221	sulfide oxidation, using sulfide:quinone oxidoreductase	IDA	biological process
GO:0070224	sulfide:quinone oxidoreductase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0048038	quinone binding	IEA	molecular function
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0005739	mitochondrion	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00920	Sulfur metabolism

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881