• Gene id: 5829

Gene Summary

• Gene Symbol: PXN   Gene   UCSC   Ensembl
• Gene name: paxillin
• Alternate names: paxillin, testicular tissue protein Li 134,
• Gene location: 12q24.23 (120265770: 120210438)     Exons: 20     NC_000012.12
• Gene summary(Entrez): This gene encodes a cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Alternatively spliced transcript variants encoding different isoforms have been described for this gene.
• OMIM: 602505

Protein Summary

• Protein general information: P49023  
  • Name: Paxillin
  • Length: 591  
  • Mass: 64505
• Sequence:

  MDDLDALLADLESTTSHISKRPVFLSEETPYSYPTGNHTYQEIAVPPPVPPPPSSEALNGTILDPLDQWQPSSSR
  FIHQQPQSSSPVYGSSAKTSSVSNPQDSVGSPCSRVGEEEHVYSFPNKQKSAEPSPTVMSTSLGSNLSELDRLLL
  ELNAVQHNPPGFPADEANSSPPLPGALSPLYGVPETNSPLGGKAGPLTKEKPKRNGGRGLEDVRPSVESLLDELE
  SSVPSPVPAITVNQGEMSSPQRVTSTQQQTRISASSATRELDELMASLSDFKIQGLEQRADGERCWAAGWPRDGG
  RSSPGGQDEGGFMAQGKTGSSSPPGGPPKPGSQLDSMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGK
  TWHPEHFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILDKVVTALDRTWHPEHFFCAQCGAFF
  GPEGFHEKDGKAYCRKDYFDMFAPKCGGCARAILENYISALNTLWHPECFVCRECFTPFVNGSFFEHDGQPYCEV
  HYHERRGSLCSGCQKPITGRCITAMAKKFHPEHFVCAFCLKQLNKGTFKEQNDKPYCQNCFLKLFC

• Structural information:
  • Protein Domains: (356..41-)
    1 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (416..47-)
    2 (/note="LIM-zinc-binding)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00125-)
    (474..53-)
    3 (/note="LIM-zinc-binding)
    (/evidence="ECO-)
  • Interpro: IPR017305  IPR001781  
  • Prosite: PS00478 PS50023
  • PDB: 1KKY 1KL0 1OW6 1OW7 1OW8 2K2R 2O9V 2VZD 2VZG 2VZI 3GM1 3PY7 3RQE 3RQF 3RQG 3U3F 4EDN 4R32 4XGZ 4XH2 5UWH 6IUI 6U4M 6U4N
  • PDBsum: 1KKY 1KL0 1OW6 1OW7 1OW8 2K2R 2O9V 2VZD 2VZG 2VZI 3GM1 3PY7 3RQE 3RQF 3RQG 3U3F 4EDN 4R32 4XGZ 4XH2 5UWH 6IUI 6U4M 6U4N
  • DIP: 33851
  • STRING: ENSP00000267257
• Other Databases: GeneCards:  PXN  Malacards:  PXN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005911	cell-cell junction	IMP	cellular component
GO:0005925	focal adhesion	IMP	cellular component
GO:0043542	endothelial cell migration	IBA	biological process
GO:0005829	cytosol	IBA	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IBA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0005925	focal adhesion	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0003712	transcription coregulator activity	IBA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005875	microtubule associated complex	TAS	cellular component
GO:0007155	cell adhesion	NAS	biological process
GO:0007172	signal complex assembly	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0006936	muscle contraction	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0048010	vascular endothelial growth factor receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0031625	ubiquitin protein ligase binding	IEA	molecular function
GO:0005178	integrin binding	IEA	molecular function
GO:0005925	focal adhesion	IEA	cellular component
GO:0019901	protein kinase binding	IEA	molecular function
GO:0044877	protein-containing complex binding	IEA	molecular function
GO:1901652	response to peptide	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0043542	endothelial cell migration	IMP	biological process
GO:0060396	growth hormone receptor signaling pathway	IDA	biological process
GO:0019903	protein phosphatase binding	IPI	molecular function
GO:0038191	neuropilin binding	IPI	molecular function
GO:0034614	cellular response to reactive oxygen species	IEP	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0030027	lamellipodium	IDA	cellular component
GO:0051496	positive regulation of stress fiber assembly	IMP	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005938	cell cortex	IEA	cellular component
GO:0005925	focal adhesion	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:1903506	regulation of nucleic acid-templated transcription	IEA	biological process
GO:0007179	transforming growth factor beta receptor signaling pathway	IDA	biological process
GO:0005925	focal adhesion	IDA	cellular component
GO:0001725	stress fiber	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005925	focal adhesion	HDA	cellular component
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0017166	vinculin binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa05165	Human papillomavirus infection
hsa05131	Shigellosis
hsa04810	Regulation of actin cytoskeleton
hsa05163	Human cytomegalovirus infection
hsa04062	Chemokine signaling pathway
hsa04510	Focal adhesion
hsa05170	Human immunodeficiency virus 1 infection
hsa05203	Viral carcinogenesis
hsa05205	Proteoglycans in cancer
hsa05135	Yersinia infection
hsa04670	Leukocyte transendothelial migration
hsa05100	Bacterial invasion of epithelial cells
hsa04370	VEGF signaling pathway
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq