• Gene id: 5824

Gene Summary

• Gene Symbol: PEX19   Gene   UCSC   Ensembl
• Aliases: D1S2223E, HK33, PBD12A, PMP1, PMPI, PXF, PXMP1
• Gene name: peroxisomal biogenesis factor 19
• Alternate names: peroxisomal biogenesis factor 19, 33 kDa housekeeping protein, housekeeping gene, 33kD, peroxin-19, peroxisomal farnesylated protein,
• Gene location: 1q23.2 (160285150: 160276806)     Exons: 8     NC_000001.11
• Gene summary(Entrez): This gene is necessary for early peroxisomal biogenesis. It acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Peroxins (PEXs) are proteins that are essential for the assembly of functional peroxisomes.
• OMIM: 600279

Protein Summary

• Protein general information: P40855  
  • Name: Peroxisomal biogenesis factor 19 (33 kDa housekeeping protein) (Peroxin 19) (Peroxisomal farnesylated protein)
  • Length: 299  
  • Mass: 32807
  • Tissue specificity: Ubiquitously expressed. Isoform 1 is strongly predominant in all tissues except in utero where isoform 2 is the main form. {ECO
• Sequence:

  MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELF
  DSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSE
  EELTKAMEGLGMDEGDGEGNILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVM
  CKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDALNLSGPPGASGEQCLIM

• Structural information:
  • Interpro: IPR006708  IPR038322  
  • PDB: 2W85 2WL8 3AJB 3MK4 5LNF
  • PDBsum: 2W85 2WL8 3AJB 3MK4 5LNF
  • DIP: 24172
  • STRING: ENSP00000357051
• Other Databases: GeneCards:  PEX19  Malacards:  PEX19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005778	peroxisomal membrane	IBA	cellular component
GO:0033328	peroxisome membrane targeting sequence binding	IBA	molecular function
GO:0045046	protein import into peroxisome membrane	IBA	biological process
GO:0047485	protein N-terminus binding	IPI	molecular function
GO:0005777	peroxisome	IEA	cellular component
GO:0007031	peroxisome organization	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0055085	transmembrane transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045046	protein import into peroxisome membrane	IDA	biological process
GO:0072321	chaperone-mediated protein transport	IDA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0061077	chaperone-mediated protein folding	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0006625	protein targeting to peroxisome	IDA	biological process
GO:0005829	cytosol	IDA	cellular component
GO:0072321	chaperone-mediated protein transport	IDA	biological process
GO:0005778	peroxisomal membrane	IDA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:1900131	negative regulation of lipid binding	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0050821	protein stabilization	IDA	biological process
GO:0045046	protein import into peroxisome membrane	IDA	biological process
GO:0036105	peroxisome membrane class-1 targeting sequence binding	IDA	molecular function
GO:0006625	protein targeting to peroxisome	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007031	peroxisome organization	IMP	biological process
GO:0007031	peroxisome organization	NAS	biological process
GO:0006625	protein targeting to peroxisome	IMP	biological process
GO:0006625	protein targeting to peroxisome	IMP	biological process
GO:0072663	establishment of protein localization to peroxisome	IMP	biological process
GO:0051117	ATPase binding	IPI	molecular function
GO:0031526	brush border membrane	ISS	cellular component
GO:0005778	peroxisomal membrane	HDA	cellular component
GO:0005777	peroxisome	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016559	peroxisome fission	IMP	biological process
GO:0005737	cytoplasm	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Peroxisome biogenesis disorder	KEGG:H00205
Zellweger syndrome	KEGG:H01342
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881