• Gene id: 58190

Gene Summary

• Gene Symbol: CTDSP1   Gene   UCSC   Ensembl
• Aliases: NIF3, NLI-IF, NLIIF, SCP1
• Gene name: CTD small phosphatase 1
• Alternate names: carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 1, NLI-interacting factor 3, nuclear LIM interactor-interacting factor 3, small C-terminal domain ph,
• Gene location: 2q35 (218398232: 218405940)     Exons: 9     NC_000002.12
• Gene summary(Entrez): This gene encodes a member of the small C-terminal domain phosphatase (SCP) family of nuclear phosphatases. These proteins play a role in transcriptional regulation through specific dephosphorylation of phosphoserine 5 within tandem heptapeptide repeats o
• OMIM: 603007

Protein Summary

• Protein general information: Q9GZU7  
  • Name: Carboxy terminal domain RNA polymerase II polypeptide A small phosphatase 1 (EC 3.1.3.16) (Nuclear LIM interactor interacting factor 3) (NLI IF) (NLI interacting factor 3) (Small C terminal domain phosphatase 1) (SCP1) (Small CTD phosphatase 1)
  • Length: 261  
  • Mass: 29203
  • Tissue specificity: Expression is restricted to non-neuronal tissues. Highest expression in skeletal muscle, spleen, lung and placenta. {ECO
• Sequence:

  MDSSAVITQISKEEARGPLRGKGDQKSAASQKPRSRGILHSLFCCVCRDDGEALPAHSGAPLLVEENGAIPKQTP
  VQYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVL
  FTASLAKYADPVADLLDKWGAFRARLFRESCVFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASW
  FDNMSDTELHDLLPFFEQLSRVDDVYSVLRQPRPGS

• Structural information:
  • Protein Domains: (86..24-)
    (/note="FCP1-homology)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00336"-)
  • Interpro: IPR011948  IPR004274  IPR036412  IPR023214  IPR040078  
  • Prosite: PS50969
  • PDB: 1T9Z 1TA0 2GHQ 2GHT 3L0B 3L0C 3L0Y 3PGL 4YGY 4YH1 6DU3
  • PDBsum: 1T9Z 1TA0 2GHQ 2GHT 3L0B 3L0C 3L0Y 3PGL 4YGY 4YH1 6DU3
  • DIP: 61246
  • STRING: ENSP00000273062
• Other Databases: GeneCards:  CTDSP1  Malacards:  CTDSP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0050768	negative regulation of neurogenesis	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IBA	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0006357	regulation of transcription by RNA polymerase II	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0008420	RNA polymerase II CTD heptapeptide repeat phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IEA	biological process
GO:0050768	negative regulation of neurogenesis	IEA	biological process
GO:0001933	negative regulation of protein phosphorylation	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	TAS	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray