• Gene id: 58189

Gene Summary

• Gene Symbol: WFDC1   Gene   UCSC   Ensembl
• Aliases: PS20
• Gene name: WAP four-disulfide core domain 1
• Alternate names: WAP four-disulfide core domain protein 1, WAP four-disulfide core domain 1 homolog, prostate stromal protein ps20, ps20 growth inhibitor,
• Gene location: 16q24.1 (84292232: 84329849)     Exons: 9     NC_000016.10
• Gene summary(Entrez): This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family me
• OMIM: 605322

Protein Summary

• Protein general information: Q9HC57  
  • Name: WAP four disulfide core domain protein 1 (Prostate stromal protein ps20) (ps20 growth inhibitor)
  • Length: 220  
  • Mass: 23977
• Sequence:

  MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQPRADRCPPPPRTLPP
  GACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDG
  AEPLLCPSGYECHILSPGDVAEGIPNRGQCVKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ

• Structural information:
  • Protein Domains: (59..10-)
    (/note="WAP-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00722"-)
  • Interpro: IPR036645  IPR008197  IPR042357  
  • Prosite: PS51390
  • STRING: ENSP00000219454
• Other Databases: GeneCards:  WFDC1  Malacards:  WFDC1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001558	regulation of cell growth	IBA	biological process
GO:0005615	extracellular space	IBA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0010466	negative regulation of peptidase activity	IEA	biological process
GO:0030414	peptidase inhibitor activity	IEA	molecular function
GO:0004867	serine-type endopeptidase inhibitor activity	IEA	molecular function
GO:0050680	negative regulation of epithelial cell proliferation	IEA	biological process
GO:0032355	response to estradiol	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0001558	regulation of cell growth	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0061045	negative regulation of wound healing	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0010951	negative regulation of endopeptidase activity	IEA	biological process
GO:0005615	extracellular space	NAS	cellular component
GO:0003674	molecular_function	ND	molecular function
GO:0030308	negative regulation of cell growth	NAS	biological process

Diseases

Associated diseases	References
Prostate cancer	PMID:15305342
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq