• Gene id: 58157

Gene Summary

• Gene Symbol: NGB   Gene   UCSC   Ensembl
• Gene name: neuroglobin
• Alternate names: neuroglobin,
• Gene location: 14q24.3 (77271311: 77265490)     Exons: 4     NC_000014.9
• Gene summary(Entrez): This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing
• OMIM: 609798

Protein Summary

• Protein general information: Q9NPG2  
  • Name: Neuroglobin
  • Length: 151  
  • Mass: 16933
  • Tissue specificity: Predominantly expressed in brain, the strongest expression is seen in the frontal lobe, the subthalamic nucleus and the thalamus. {ECO
• Sequence:

  MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPEFLDHIRKVMLVIDAA
  VTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKCLGPAFTPATRAAWSQLYGAVVQAMSRGWDG
  E

• Structural information:
  • Interpro: IPR000971  IPR009050  IPR012292  
  • Prosite: PS01033
  • PDB: 1OJ6 4MPM
  • PDBsum: 1OJ6 4MPM
  • STRING: ENSP00000298352
• Other Databases: GeneCards:  NGB  Malacards:  NGB

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0020037	heme binding	IEA	molecular function
GO:0019825	oxygen binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005344	oxygen carrier activity	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0015671	oxygen transport	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0015671	oxygen transport	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0005344	oxygen carrier activity	TAS	molecular function
GO:0015671	oxygen transport	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881