• Gene id: 581

Gene Summary

• Gene Symbol: BAX   Gene   UCSC   Ensembl
• Aliases: BCL2L4
• Gene name: BCL2 associated X, apoptosis regulator
• Alternate names: apoptosis regulator BAX, BCL2 associated X protein, BCL2-associated X protein omega, Baxdelta2G9, Baxdelta2G9omega, Baxdelta2omega, bcl-2-like protein 4, bcl2-L-4,
• Gene location: 19q13.33 (48954824: 48961797)     Exons: 7     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer w
• OMIM: 600040

SNPs

rs779944215

Strand:    Allele origin:   Allele change:   Mutation type: delins

NC_000001.11   g.167880125_167880126GT[1]
NC_000001.10   g.167849363_167849364GT[1]
NG_016139.1   g.39088_39089AC[1]
NM_018417.6   c.1203_1204AC[1]
NM_018417.5   c.1203_1204AC[1]
NM_018417.4   c.1203_1204AC[1]
NM_001167749.3   c.744_745AC[1]
NM_001167749.2   c.744_7

rs34605051

Strand:    Allele origin:   Allele change:   Mutation type: snv

NC_000002.12   g.86466703T>C
NC_000002.11   g.86693826T>C
NG_047167.1   g.31057T>C
NM_018433.6   c.1339T>C
NM_018433.5   c.1339T>C
NM_001146688.1   c.1339T>C
XM_006712051.4   c.-637T>C
XM_024452995.1   c.1339T>C
XM_024452994.1   c.1339T>C
XM_017004494.1   c.484T>C
XM_02  

Protein Summary

• Protein general information: Q07812  
  • Name: Apoptosis regulator BAX (Bcl 2 like protein 4) (Bcl2 L 4)
  • Length: 192  
  • Mass: 21,184
  • Tissue specificity: Blood plasma, seminal plasma, urine, saliva, sweat, epithelial cells of various human glands, liver.
• Sequence:

  MDGSGEQPRGGGPTSSEQIMKTGALLLQGFIQDRAGRMGGEAPELALDPVPQDASTKKLSECLKRIGDELDSNME
  LQRMIAAVDTDSPREVFFRVAADMFSDGNFNWGRVVALFYFASKLVLKALCTKVPELIRTIMGWTLDFLRERLLG
  WIQDQGGWDGLLSYFGTPTWQTVTIFVAGVLTASLTIWKKMG

• Structural information:
  • Interpro: IPR026304  IPR002475  IPR020717  IPR020726  IPR020728   IPR036834  IPR026298  
  • Prosite: PS50062 PS01080 PS01258 PS01259
  • PDB: 1F16 2G5B 2K7W 2LR1 3PK1 3PL7 4BD2 4BD6 4BD7 4BD8 4BDU 4S0O 4S0P 4UF2 4ZIE 4ZIF 4ZIG 4ZIH 4ZII
  • PDBsum: 1F16 2G5B 2K7W 2LR1 3PK1 3PL7 4BD2 4BD6 4BD7 4BD8 4BDU 4S0O 4S0P 4UF2 4ZIE 4ZIF 4ZIG 4ZIH 4ZII
  • DIP: 232
  • STRING: ENSP00000293288
• Other Databases: GeneCards:  BAX  Malacards:  BAX

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001541	ovarian follicle development	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001777	T cell homeostatic proliferation	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0001783	B cell apoptotic process	IDA	biological process
GO:0001783	B cell apoptotic process	IDA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0002352	B cell negative selection	IEA	biological process
GO:0002358	B cell homeostatic proliferation	IEA	biological process
GO:0002904	positive regulation of B cell apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IMP	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005757	mitochondrial permeability transition pore complex	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	IEA	biological process
GO:0006808	regulation of nitrogen utilization	IEA	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0006987	activation of signaling protein activity involved in unfolded protein response	TAS	biological process
GO:0007007	inner mitochondrial membrane organization	IEA	biological process
GO:0007008	outer mitochondrial membrane organization	IEA	biological process
GO:0007281	germ cell development	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008053	mitochondrial fusion	IDA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IC	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IDA	biological process
GO:0008637	apoptotic mitochondrial changes	IDA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0009651	response to salt stress	IEA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IDA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0015267	channel activity	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0021854	hypothalamus development	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032461	positive regulation of protein oligomerization	IDA	biological process
GO:0032469	endoplasmic reticulum calcium ion homeostasis	TAS	biological process
GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration	IEA	biological process
GO:0032976	release of matrix enzymes from mitochondria	IDA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0033599	regulation of mammary gland epithelial cell proliferation	IEA	biological process
GO:0034349	glial cell apoptotic process	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0035234	ectopic germ cell programmed cell death	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043496	regulation of protein homodimerization activity	IDA	biological process
GO:0043497	regulation of protein heterodimerization activity	IPI	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IDA	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IDA	biological process
GO:0045136	development of secondary sexual characteristics	IEA	biological process
GO:0045333	cellular respiration	IEA	biological process
GO:0046666	retinal cell programmed cell death	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0046930	pore complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048087	positive regulation of developmental pigmentation	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048515	spermatid differentiation	IEA	biological process
GO:0048597	post-embryonic camera-type eye morphogenesis	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0051259	protein oligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:0051434	BH3 domain binding	IPI	molecular function
GO:0051434	BH3 domain binding	IPI	molecular function
GO:0051434	BH3 domain binding	IDA	molecular function
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0060011	Sertoli cell proliferation	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0060058	positive regulation of apoptotic process involved in mammary gland involution	IEA	biological process
GO:0060068	vagina development	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070242	thymocyte apoptotic process	IEA	biological process
GO:0070584	mitochondrion morphogenesis	IEA	biological process
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IEA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0097136	Bcl-2 family protein complex	IDA	cellular component
GO:0097144	BAX complex	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IEA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS	biological process
GO:1902262	apoptotic process involved in blood vessel morphogenesis	IEA	biological process
GO:1902263	apoptotic process involved in embryonic digit morphogenesis	IEA	biological process
GO:1902445	regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IEA	biological process
GO:1902512	positive regulation of apoptotic DNA fragmentation	IMP	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:1990117	B cell receptor apoptotic signaling pathway	IDA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0001541	ovarian follicle development	IEA	biological process
GO:0001764	neuron migration	IEA	biological process
GO:0001776	leukocyte homeostasis	IEA	biological process
GO:0001777	T cell homeostatic proliferation	IEA	biological process
GO:0001782	B cell homeostasis	IEA	biological process
GO:0001783	B cell apoptotic process	IEA	biological process
GO:0001783	B cell apoptotic process	IDA	biological process
GO:0001783	B cell apoptotic process	IDA	biological process
GO:0001822	kidney development	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IEA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	IEA	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0001974	blood vessel remodeling	IEA	biological process
GO:0002262	myeloid cell homeostasis	IEA	biological process
GO:0002352	B cell negative selection	IEA	biological process
GO:0002358	B cell homeostatic proliferation	IEA	biological process
GO:0002904	positive regulation of B cell apoptotic process	IEA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005622	intracellular	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IMP	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IEA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005757	mitochondrial permeability transition pore complex	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006687	glycosphingolipid metabolic process	IEA	biological process
GO:0006808	regulation of nitrogen utilization	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006915	apoptotic process	IMP	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IEA	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0006987	activation of signaling protein activity involved in unfolded protein response	TAS	biological process
GO:0007007	inner mitochondrial membrane organization	IEA	biological process
GO:0007008	outer mitochondrial membrane organization	IEA	biological process
GO:0007281	germ cell development	IEA	biological process
GO:0007283	spermatogenesis	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0007420	brain development	IEA	biological process
GO:0007548	sex differentiation	IEA	biological process
GO:0007568	aging	IEA	biological process
GO:0008053	mitochondrial fusion	IEA	biological process
GO:0008053	mitochondrial fusion	IDA	biological process
GO:0008283	cell proliferation	IEA	biological process
GO:0008285	negative regulation of cell proliferation	IEA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0008584	male gonad development	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IEA	biological process
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IC	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IEA	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IEA	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IDA	biological process
GO:0008637	apoptotic mitochondrial changes	IEA	biological process
GO:0008637	apoptotic mitochondrial changes	IDA	biological process
GO:0009566	fertilization	IEA	biological process
GO:0009611	response to wounding	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0009651	response to salt stress	IEA	biological process
GO:0009791	post-embryonic development	IEA	biological process
GO:0010212	response to ionizing radiation	IEA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IDA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0010524	positive regulation of calcium ion transport into cytosol	IEA	biological process
GO:0015267	channel activity	IDA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0021854	hypothalamus development	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0031072	heat shock protein binding	IEA	molecular function
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0031966	mitochondrial membrane	IEA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032403	protein complex binding	IEA	molecular function
GO:0032461	positive regulation of protein oligomerization	IDA	biological process
GO:0032469	endoplasmic reticulum calcium ion homeostasis	TAS	biological process
GO:0032471	negative regulation of endoplasmic reticulum calcium ion concentration	IEA	biological process
GO:0032976	release of matrix enzymes from mitochondria	IDA	biological process
GO:0033137	negative regulation of peptidyl-serine phosphorylation	IEA	biological process
GO:0033599	regulation of mammary gland epithelial cell proliferation	IEA	biological process
GO:0034349	glial cell apoptotic process	IEA	biological process
GO:0034644	cellular response to UV	IEA	biological process
GO:0035108	limb morphogenesis	IEA	biological process
GO:0035234	ectopic germ cell programmed cell death	IEA	biological process
GO:0042220	response to cocaine	IEA	biological process
GO:0042475	odontogenesis of dentin-containing tooth	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042981	regulation of apoptotic process	IEA	biological process
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IEA	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043281	regulation of cysteine-type endopeptidase activity involved in apoptotic process	IEA	biological process
GO:0043496	regulation of protein homodimerization activity	IDA	biological process
GO:0043497	regulation of protein heterodimerization activity	IPI	biological process
GO:0043523	regulation of neuron apoptotic process	IEA	biological process
GO:0043524	negative regulation of neuron apoptotic process	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IEA	biological process
GO:0043525	positive regulation of neuron apoptotic process	IDA	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IDA	biological process
GO:0045136	development of secondary sexual characteristics	IEA	biological process
GO:0045333	cellular respiration	IEA	biological process
GO:0046666	retinal cell programmed cell death	IEA	biological process
GO:0046688	response to copper ion	IEA	biological process
GO:0046930	pore complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IEA	molecular function
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0048087	positive regulation of developmental pigmentation	IEA	biological process
GO:0048147	negative regulation of fibroblast proliferation	IEA	biological process
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0048515	spermatid differentiation	IEA	biological process
GO:0048597	post-embryonic camera-type eye morphogenesis	IEA	biological process
GO:0048678	response to axon injury	IEA	biological process
GO:0048872	homeostasis of number of cells	IEA	biological process
GO:0048873	homeostasis of number of cells within a tissue	IEA	biological process
GO:0051087	chaperone binding	IEA	molecular function
GO:0051259	protein oligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IEA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0051400	BH domain binding	IEA	molecular function
GO:0051402	neuron apoptotic process	IEA	biological process
GO:0051412	response to corticosterone	IEA	biological process
GO:0051434	BH3 domain binding	IPI	molecular function
GO:0051434	BH3 domain binding	IPI	molecular function
GO:0051434	BH3 domain binding	IDA	molecular function
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0060011	Sertoli cell proliferation	IEA	biological process
GO:0060041	retina development in camera-type eye	IEA	biological process
GO:0060058	positive regulation of apoptotic process involved in mammary gland involution	IEA	biological process
GO:0060068	vagina development	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070242	thymocyte apoptotic process	IEA	biological process
GO:0070584	mitochondrion morphogenesis	IEA	biological process
GO:0071310	cellular response to organic substance	IEA	biological process
GO:0072332	intrinsic apoptotic signaling pathway by p53 class mediator	IEA	biological process
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0097136	Bcl-2 family protein complex	IDA	cellular component
GO:0097144	BAX complex	IEA	cellular component
GO:0097144	BAX complex	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097296	activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway	IEA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS	biological process
GO:1902108	regulation of mitochondrial membrane permeability involved in apoptotic process	IEA	biological process
GO:1902110	positive regulation of mitochondrial membrane permeability involved in apoptotic process	IEA	biological process
GO:1902262	apoptotic process involved in blood vessel morphogenesis	IEA	biological process
GO:1902263	apoptotic process involved in embryonic digit morphogenesis	IEA	biological process
GO:1902445	regulation of mitochondrial membrane permeability involved in programmed necrotic cell death	IEA	biological process
GO:1902512	positive regulation of apoptotic DNA fragmentation	IMP	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:1990117	B cell receptor apoptotic signaling pathway	IDA	biological process
GO:2001234	negative regulation of apoptotic signaling pathway	IEA	biological process
GO:2001241	positive regulation of extrinsic apoptotic signaling pathway in absence of ligand	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IEA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:0001783	B cell apoptotic process	IDA	biological process
GO:0001783	B cell apoptotic process	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001836	release of cytochrome c from mitochondria	IDA	biological process
GO:0001844	protein insertion into mitochondrial membrane involved in apoptotic signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IMP	cellular component
GO:0005635	nuclear envelope	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0005741	mitochondrial outer membrane	IBA	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005741	mitochondrial outer membrane	TAS	cellular component
GO:0005757	mitochondrial permeability transition pore complex	IDA	cellular component
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005789	endoplasmic reticulum membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006915	apoptotic process	IMP	biological process
GO:0006915	apoptotic process	IDA	biological process
GO:0006915	apoptotic process	NAS	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IMP	biological process
GO:0006919	activation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0006927	obsolete transformed cell apoptotic process	IMP	biological process
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0006987	activation of signaling protein activity involved in unfolded protein response	TAS	biological process
GO:0008053	mitochondrial fusion	IDA	biological process
GO:0008289	lipid binding	IDA	molecular function
GO:0008625	extrinsic apoptotic signaling pathway via death domain receptors	IC	biological process
GO:0008630	intrinsic apoptotic signaling pathway in response to DNA damage	IBA	biological process
GO:0008635	activation of cysteine-type endopeptidase activity involved in apoptotic process by cytochrome c	IDA	biological process
GO:0008637	apoptotic mitochondrial changes	IDA	biological process
GO:0009636	response to toxic substance	IDA	biological process
GO:0010248	establishment or maintenance of transmembrane electrochemical gradient	IDA	biological process
GO:0015267	channel activity	IDA	molecular function
GO:0016020	membrane	IDA	cellular component
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0032461	positive regulation of protein oligomerization	IDA	biological process
GO:0032469	endoplasmic reticulum calcium ion homeostasis	TAS	biological process
GO:0032976	release of matrix enzymes from mitochondria	IDA	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0042981	regulation of apoptotic process	TAS	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0043496	regulation of protein homodimerization activity	IDA	biological process
GO:0043497	regulation of protein heterodimerization activity	IPI	biological process
GO:0043525	positive regulation of neuron apoptotic process	IDA	biological process
GO:0043653	mitochondrial fragmentation involved in apoptotic process	IDA	biological process
GO:0046930	pore complex	IDA	cellular component
GO:0046982	protein heterodimerization activity	IPI	molecular function
GO:0051259	protein oligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051260	protein homooligomerization	IDA	biological process
GO:0051434	BH3 domain binding	IPI	molecular function
GO:0051434	BH3 domain binding	IPI	molecular function
GO:0051434	BH3 domain binding	IDA	molecular function
GO:0051881	regulation of mitochondrial membrane potential	IDA	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	biological process
GO:0070059	intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0090200	positive regulation of release of cytochrome c from mitochondria	IDA	biological process
GO:0097136	Bcl-2 family protein complex	IDA	cellular component
GO:0097144	BAX complex	IDA	cellular component
GO:0097190	apoptotic signaling pathway	IDA	biological process
GO:0097191	extrinsic apoptotic signaling pathway	IDA	biological process
GO:0097192	extrinsic apoptotic signaling pathway in absence of ligand	IBA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:0097193	intrinsic apoptotic signaling pathway	IDA	biological process
GO:1900103	positive regulation of endoplasmic reticulum unfolded protein response	IMP	biological process
GO:1901030	positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	TAS	biological process
GO:1902512	positive regulation of apoptotic DNA fragmentation	IMP	biological process
GO:1903896	positive regulation of IRE1-mediated unfolded protein response	TAS	biological process
GO:1990117	B cell receptor apoptotic signaling pathway	IDA	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process
GO:2001244	positive regulation of intrinsic apoptotic signaling pathway	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa00140	Steroid hormone biosynthesis
hsa00250	Alanine, aspartate and glutamate metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa04141	Protein processing in endoplasmic reticulum
hsa04130	SNARE interactions in vesicular transport
hsa04120	Ubiquitin mediated proteolysis
hsa03018	RNA degradation
hsa03420	Nucleotide excision repair
hsa03460	Fanconi anemia pathway
hsa03460	Fanconi anemia pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04014	Ras signaling pathway
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04015	Rap1 signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04010	MAPK signaling pathway
hsa04012	ErbB signaling pathway
hsa04012	ErbB signaling pathway
hsa04012	ErbB signaling pathway
hsa04310	Wnt signaling pathway
hsa04350	TGF-beta signaling pathway
hsa04350	TGF-beta signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04390	Hippo signaling pathway
hsa04370	VEGF signaling pathway
hsa04370	VEGF signaling pathway
hsa04371	Apelin signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04630	JAK-STAT signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04064	NF-kappa B signaling pathway
hsa04071	Sphingolipid signaling pathway
hsa04210	Apoptosis
hsa04215	Apoptosis - multiple species
hsa04217	Necroptosis
hsa04115	p53 signaling pathway
hsa04722	Neurotrophin signaling pathway
hsa04211	Longevity regulating pathway
hsa05200	Pathways in cancer
hsa05202	Transcriptional misregulation in cancer
hsa05203	Viral carcinogenesis
hsa05210	Colorectal cancer
hsa05212	Pancreatic cancer
hsa05225	Hepatocellular carcinoma
hsa05226	Gastric cancer
hsa05214	Glioma
hsa05216	Thyroid cancer
hsa05220	Chronic myeloid leukemia
hsa05217	Basal cell carcinoma
hsa05218	Melanoma
hsa05213	Endometrial cancer
hsa05224	Breast cancer
hsa05222	Small cell lung cancer
hsa05223	Non-small cell lung cancer
hsa05014	Amyotrophic lateral sclerosis
hsa05016	Huntington disease
hsa05020	Prion diseases
hsa04932	Non-alcoholic fatty liver disease
hsa04933	AGE-RAGE signaling pathway in diabetic complications
hsa05130	Pathogenic Escherichia coli infection
hsa05152	Tuberculosis
hsa05166	Human T-cell leukemia virus 1 infection
hsa05170	Human immunodeficiency virus 1 infection
hsa05162	Measles
hsa05164	Influenza A
hsa05161	Hepatitis B
hsa05160	Hepatitis C
hsa05168	Herpes simplex virus 1 infection
hsa05163	Human cytomegalovirus infection
hsa05167	Kaposi sarcoma-associated herpesvirus infection
hsa05169	Epstein-Barr virus infection
hsa05165	Human papillomavirus infection
hsa01521	EGFR tyrosine kinase inhibitor resistance
hsa01524	Platinum drug resistance
hsa01522	Endocrine resistance

Diseases

Associated diseases	References
Cancer (Chronic B-Cell Leukemias)	GAD: 17981213
Cancer (colorectal)	GAD: 16380996
Cancer (lymphoma)	GAD: 19336552
Cancer (Squamous cell)	GAD: 17693666
Colorectal cancer	KEGG: H00020
Cancer	GAD: 19888426
Cancer (B cell chronic lymphocytic leukaemia)	GAD: 12890741
Cancer (bladder)	GAD: 19692168
Cancer (esophageal)	GAD: 20453000
Cancer (head and neck)	GAD: 20819778
Cancer (leukemia)	GAD: 15735127
Cancer (lung)	GAD: 18676680
Hodgkin disease	GAD: 19573080
Multiple sclerosis	GAD: 12161031
Osteomyelitis	GAD: 17438390
Bone diseases	GAD: 19453261
Parkinson disease	GAD: 18568448
Chronic renal failure	GAD: 21085059
Chronic endometritis	INFBASE: 23351011
Endometriosis	INFBASE: 19112572
Female infertility	INFBASE: 25912412
Polycystic ovary syndrome (PCOS)	INFBASE: 17030058
Polycystic ovary syndrome (PCOS)	INFBASE: 17008325
Unexplained infertility	INFBASE: 16139338
Azoospermia	MIK: 26056927
Hyperplasia	MIK: 7569956
Male factor infertility	MIK: 26056927
Varicocele	MIK: 25168538
Non obstructive azoospermia	MIK: 26056927
Chronic obstructive pulmonary disease (COPD)	GAD: 19625176
Pemphigus vulgaris	GAD: 16611260
Associated with spermatogenesis and epigenetic regulation	MIK: 21674046
Azoospermia	MIK: 26056927
Cryptorchidism	MIK: 21412036
hyperplasia	MIK: 7569956
Male infertility	MIK: 26056927
Varicocele	MIK: 25986829
Nonobstructive azoospermia	MIK: 26056927
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25168538	Male infertility with varicocele			111 (20 healthy fertile men, 16 fertile women with varicocele, 29 infertile oligoasthenoteratozoospermic men without varocele, 46 infertile oligoasthenoteratozoospermic men with Vx )	Male infertility	BAX BCL2
25986829	Male infertility, varicocele				Male infertility	BAX BCL2
7569956	hyperplasia				Male infertility	BAX BCL2
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21412036	Cryptorchidism			23 (4 controls, 19 cases)	Male infertility	GSE25518 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Associated with spermatogenesis and epigenetic regulation			18	Male infertility	GSE26881