• Gene id: 5802

Gene Summary

• Gene Symbol: PTPRS   Gene   UCSC   Ensembl
• Aliases: PTPSIGMA, R-PTP-S, R-PTP-sigma
• Gene name: protein tyrosine phosphatase receptor type S
• Alternate names: receptor-type tyrosine-protein phosphatase S, protein tyrosine phosphatase PTPsigma, receptor-type tyrosine-protein phosphatase sigma,
• Gene location: 19p13.3 (5340811: 5205502)     Exons: 41     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran
• OMIM: 182160

Protein Summary

• Protein general information: Q13332  
  • Name: Receptor type tyrosine protein phosphatase S (R PTP S) (EC 3.1.3.48) (Receptor type tyrosine protein phosphatase sigma) (R PTP sigma)
  • Length: 1948  
  • Mass: 217041
  • Tissue specificity: Detected in peripheral blood plasmacytoid dendritic cells (at protein level) (PubMed
• Sequence:

  MAPTWGPGMVSVVGPMGLLVVLLVGGCAAEEPPRFIKEPKDQIGVSGGVASFVCQATGDPKPRVTWNKKGKKVNS
  QRFETIEFDESAGAVLRIQPLRTPRDENVYECVAQNSVGEITVHAKLTVLREDQLPSGFPNIDMGPQLKVVERTR
  TATMLCAASGNPDPEITWFKDFLPVDPSASNGRIKQLRSETFESTPIRGALQIESSEETDQGKYECVATNSAGVR
  YSSPANLYVRELREVRRVAPRFSILPMSHEIMPGGNVNITCVAVGSPMPYVKWMQGAEDLTPEDDMPVGRNVLEL
  TDVKDSANYTCVAMSSLGVIEAVAQITVKSLPKAPGTPMVTENTATSITITWDSGNPDPVSYYVIEYKSKSQDGP
  YQIKEDITTTRYSIGGLSPNSEYEIWVSAVNSIGQGPPSESVVTRTGEQAPASAPRNVQARMLSATTMIVQWEEP
  VEPNGLIRGYRVYYTMEPEHPVGNWQKHNVDDSLLTTVGSLLEDETYTVRVLAFTSVGDGPLSDPIQVKTQQGVP
  GQPMNLRAEARSETSITLSWSPPRQESIIKYELLFREGDHGREVGRTFDPTTSYVVEDLKPNTEYAFRLAARSPQ
  GLGAFTPVVRQRTLQSKPSAPPQDVKCVSVRSTAILVSWRPPPPETHNGALVGYSVRYRPLGSEDPEPKEVNGIP
  PTTTQILLEALEKWTQYRITTVAHTEVGPGPESSPVVVRTDEDVPSAPPRKVEAEALNATAIRVLWRSPAPGRQH
  GQIRGYQVHYVRMEGAEARGPPRIKDVMLADAQWETDDTAEYEMVITNLQPETAYSITVAAYTMKGDGARSKPKV
  VVTKGAVLGRPTLSVQQTPEGSLLARWEPPAGTAEDQVLGYRLQFGREDSTPLATLEFPPSEDRYTASGVHKGAT
  YVFRLAARSRGGLGEEAAEVLSIPEDTPRGHPQILEAAGNASAGTVLLRWLPPVPAERNGAIVKYTVAVREAGAL
  GPARETELPAAAEPGAENALTLQGLKPDTAYDLQVRAHTRRGPGPFSPPVRYRTFLRDQVSPKNFKVKMIMKTSV
  LLSWEFPDNYNSPTPYKIQYNGLTLDVDGRTTKKLITHLKPHTFYNFVLTNRGSSLGGLQQTVTAWTAFNLLNGK
  PSVAPKPDADGFIMVYLPDGQSPVPVQSYFIVMVPLRKSRGGQFLTPLGSPEDMDLEELIQDISRLQRRSLRHSR
  QLEVPRPYIAARFSVLPPTFHPGDQKQYGGFDNRGLEPGHRYVLFVLAVLQKSEPTFAASPFSDPFQLDNPDPQP
  IVDGEEGLIWVIGPVLAVVFIICIVIAILLYKNKPDSKRKDSEPRTKCLLNNADLAPHHPKDPVEMRRINFQTPD
  SGLRSPLREPGFHFESMLSHPPIPIADMAEHTERLKANDSLKLSQEYESIDPGQQFTWEHSNLEVNKPKNRYANV
  IAYDHSRVILQPIEGIMGSDYINANYVDGYRCQNAYIATQGPLPETFGDFWRMVWEQRSATIVMMTRLEEKSRIK
  CDQYWPNRGTETYGFIQVTLLDTIELATFCVRTFSLHKNGSSEKREVRQFQFTAWPDHGVPEYPTPFLAFLRRVK
  TCNPPDAGPIVVHCSAGVGRTGCFIVIDAMLERIKPEKTVDVYGHVTLMRSQRNYMVQTEDQYSFIHEALLEAVG
  CGNTEVPARSLYAYIQKLAQVEPGEHVTGMELEFKRLANSKAHTSRFISANLPCNKFKNRLVNIMPYESTRVCLQ
  PIRGVEGSDYINASFIDGYRQQKAYIATQGPLAETTEDFWRMLWENNSTIVVMLTKLREMGREKCHQYWPAERSA
  RYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTVRQFQFTDWPEQGVPKSGEGFIDFIGQVHKTKEQFGQDGP
  ISVHCSAGVGRTGVFITLSIVLERMRYEGVVDIFQTVKMLRTQRPAMVQTEDEYQFCYQAALEYLGSFDHYAT

• Structural information:
  • Protein Domains: (33..12-)
    1 (/note="Ig-like-C2-type)
    (135..23-)
    2 (/note="Ig-like-C2-type)
    (245..32-)
    3 (/note="Ig-like-C2-type)
    (334..42-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (429..52-)
    (/n-)
  • Interpro: IPR003961  IPR036116  IPR007110  IPR036179  IPR013783   IPR013098  IPR003599  IPR003598  IPR029021  IPR000242  IPR016130  IPR003595  IPR000387  
  • Prosite: PS50853 PS50835 PS00383 PS50056 PS50055
  • CDD: cd00063
  • PDB: 2FH7 2YD2 2YD3 2YD9 4BPC 4PBX
  • PDBsum: 2FH7 2YD2 2YD3 2YD9 4BPC 4PBX
  • STRING: ENSP00000349932
• Other Databases: GeneCards:  PTPRS  Malacards:  PTPRS

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0099560	synaptic membrane adhesion	IBA	biological process
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0032687	negative regulation of interferon-alpha production	IMP	biological process
GO:0034164	negative regulation of toll-like receptor 9 signaling pathway	IMP	biological process
GO:0004725	protein tyrosine phosphatase activity	ISS	molecular function
GO:0061000	negative regulation of dendritic spine development	ISS	biological process
GO:0048671	negative regulation of collateral sprouting	ISS	biological process
GO:0030517	negative regulation of axon extension	ISS	biological process
GO:0030424	axon	ISS	cellular component
GO:0030285	integral component of synaptic vesicle membrane	ISS	cellular component
GO:0035374	chondroitin sulfate binding	ISS	molecular function
GO:0048681	negative regulation of axon regeneration	ISS	biological process
GO:0032688	negative regulation of interferon-beta production	IMP	biological process
GO:0008201	heparin binding	ISS	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	ISS	biological process
GO:0043395	heparan sulfate proteoglycan binding	ISS	molecular function
GO:0008201	heparin binding	ISS	molecular function
GO:0099061	integral component of postsynaptic density membrane	ISS	cellular component
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0007155	cell adhesion	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0021510	spinal cord development	IEA	biological process
GO:0021549	cerebellum development	IEA	biological process
GO:0021766	hippocampus development	IEA	biological process
GO:0030517	negative regulation of axon extension	IEA	biological process
GO:0035374	chondroitin sulfate binding	IEA	molecular function
GO:0048671	negative regulation of collateral sprouting	IEA	biological process
GO:0048681	negative regulation of axon regeneration	IEA	biological process
GO:0050808	synapse organization	IEA	biological process
GO:0061000	negative regulation of dendritic spine development	IEA	biological process
GO:0090557	establishment of endothelial intestinal barrier	IEA	biological process
GO:0098685	Schaffer collateral - CA1 synapse	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0010977	negative regulation of neuron projection development	IEA	biological process
GO:0021987	cerebral cortex development	IEA	biological process
GO:0022038	corpus callosum development	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0050804	modulation of chemical synaptic transmission	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0099151	regulation of postsynaptic density assembly	IEA	biological process
GO:0043204	perikaryon	IEA	cellular component
GO:0014069	postsynaptic density	IEA	cellular component
GO:0030672	synaptic vesicle membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0099560	synaptic membrane adhesion	IMP	biological process
GO:0099560	synaptic membrane adhesion	IMP	biological process
GO:0099560	synaptic membrane adhesion	IDA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray