• Gene id: 5800

Gene Summary

• Gene Symbol: PTPRO   Gene   UCSC   Ensembl
• Aliases: GLEPP1, NPHS6, PTP-OC, PTP-U2, PTPROT, PTPU2, R-PTP-O
• Gene name: protein tyrosine phosphatase receptor type O
• Alternate names: receptor-type tyrosine-protein phosphatase O, PTP phi, PTPase U2, glomerular epithelial protein 1, osteoclastic transmembrane protein-tyrosine phosphatase, phosphotyrosine phosphatase U2, protein tyrosine phosphatase PTP-U2,
• Gene location: 12p13-p12 (15322333: 15598330)     Exons: 28     NC_000012.12
• Gene summary(Entrez): This gene encodes a member of the R3 subtype family of receptor-type protein tyrosine phosphatases. These proteins are localized to the apical surface of polarized cells and may have tissue-specific functions through activation of Src family kinases. This
• OMIM: 606034

Protein Summary

• Protein general information: Q16827  
  • Name: Receptor type tyrosine protein phosphatase O (R PTP O) (EC 3.1.3.48) (Glomerular epithelial protein 1) (Protein tyrosine phosphatase U2) (PTP U2) (PTPase U2)
  • Length: 1216  
  • Mass: 138344
  • Tissue specificity: Glomerulus of kidney. Also detected in brain, lung and placenta. {ECO
• Sequence:

  MGHLPTGIHGARRLLPLLWLFVLFKNATAFHVTVQDDNNIVVSLEASDVISPASVYVVKITGESKNYFFEFEEFN
  STLPPPVIFKASYHGLYYIITLVVVNGNVVTKPSRSITVLTKPLPVTSVSIYDYKPSPETGVLFEIHYPEKYNVF
  TRVNISYWEGKDFRTMLYKDFFKGKTVFNHWLPGMCYSNITFQLVSEATFNKSTLVEYSGVSHEPKQHRTAPYPP
  QNISVRIVNLNKNNWEEQSGNFPEESFMRSQDTIGKEKLFHFTEETPEIPSGNISSGWPDFNSSDYETTSQPYWW
  DSASAAPESEDEFVSVLPMEYENNSTLSETEKSTSGSFSFFPVQMILTWLPPKPPTAFDGFHIHIEREENFTEYL
  MVDEEAHEFVAELKEPGKYKLSVTTFSSSGSCETRKSQSAKSLSFYISPSGEWIEELTEKPQHVSVHVLSSTTAL
  MSWTSSQENYNSTIVSVVSLTCQKQKESQRLEKQYCTQVNSSKPIIENLVPGAQYQVVIYLRKGPLIGPPSDPVT
  FAIVPTGIKDLMLYPLGPTAVVLSWTRPYLGVFRKYVVEMFYFNPATMTSEWTTYYEIAATVSLTASVRIANLLP
  AWYYNFRVTMVTWGDPELSCCDSSTISFITAPVAPEITSVEYFNSLLYISWTYGDDTTDLSHSRMLHWMVVAEGK
  KKIKKSVTRNVMTAILSLPPGDIYNLSVTACTERGSNTSMLRLVKLEPAPPKSLFAVNKTQTSVTLLWVEEGVAD
  FFEVFCQQVGSSQKTKLQEPVAVSSHVVTISSLLPATAYNCSVTSFSHDSPSVPTFIAVSTMVTEMNPNVVVISV
  LAILSTLLIGLLLVTLIILRKKHLQMARECGAGTFVNFASLERDGKLPYNWRRSIFAFLTLLPSCLWTDYLLAFY
  INPWSKNGLKKRKLTNPVQLDDFDAYIKDMAKDSDYKFSLQFEELKLIGLDIPHFAADLPLNRCKNRYTNILPYD
  FSRVRLVSMNEEEGADYINANYIPGYNSPQEYIATQGPLPETRNDFWKMVLQQKSQIIVMLTQCNEKRRVKCDHY
  WPFTEEPIAYGDITVEMISEEEQDDWACRHFRINYADEMQDVMHFNYTAWPDHGVPTANAAESILQFVHMVRQQA
  TKSKGPMIIHCSAGVGRTGTFIALDRLLQHIRDHEFVDILGLVSEMRSYRMSMVQTEEQYIFIHQCVQLMWMKKK
  QQFCISDVIYENVSKS

• Structural information:
  • Protein Domains: (50..12-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (142..21-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (246..30-)
    3 (/note="Fibronectin-type-III)
    (/ev-)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR029021  IPR000242   IPR042996  IPR016130  IPR003595  IPR000387  
  • Prosite: PS50853 PS00383 PS50056 PS50055
  • CDD: cd00063
  • PDB: 2G59 2GJT
  • PDBsum: 2G59 2GJT
  • STRING: ENSP00000281171
• Other Databases: GeneCards:  PTPRO  Malacards:  PTPRO

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045296	cadherin binding	IPI	molecular function
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IBA	biological process
GO:0098978	glutamatergic synapse	IBA	cellular component
GO:0045296	cadherin binding	IBA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0098982	GABA-ergic synapse	IBA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	IBA	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	IBA	biological process
GO:0017147	Wnt-protein binding	IBA	molecular function
GO:0007411	axon guidance	IBA	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0003093	regulation of glomerular filtration	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0003093	regulation of glomerular filtration	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0000902	cell morphogenesis	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0016328	lateral plasma membrane	IEA	cellular component
GO:0030032	lamellipodium assembly	IEA	biological process
GO:0036060	slit diaphragm assembly	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IEA	biological process
GO:0003105	negative regulation of glomerular filtration	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0003093	regulation of glomerular filtration	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0007411	axon guidance	IEA	biological process
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0017147	Wnt-protein binding	IEA	molecular function
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0043197	dendritic spine	IEA	cellular component
GO:0050807	regulation of synapse organization	IEA	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	IEA	biological process
GO:0090090	negative regulation of canonical Wnt signaling pathway	IEA	biological process
GO:0098982	GABA-ergic synapse	IEA	cellular component
GO:0099061	integral component of postsynaptic density membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0090260	negative regulation of retinal ganglion cell axon guidance	ISS	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0030424	axon	ISS	cellular component
GO:0030032	lamellipodium assembly	ISS	biological process
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0006470	protein dephosphorylation	ISS	biological process
GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	NAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0090090	negative regulation of canonical Wnt signaling pathway	ISS	biological process
GO:0043197	dendritic spine	ISS	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0030426	growth cone	ISS	cellular component
GO:0030027	lamellipodium	ISS	cellular component
GO:0017147	Wnt-protein binding	ISS	molecular function
GO:0016791	phosphatase activity	ISS	molecular function
GO:0010977	negative regulation of neuron projection development	ISS	biological process
GO:0010812	negative regulation of cell-substrate adhesion	ISS	biological process
GO:0007411	axon guidance	ISS	biological process
GO:0005887	integral component of plasma membrane	NAS	cellular component
GO:0005886	plasma membrane	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0036060	slit diaphragm assembly	NAS	biological process
GO:0036060	slit diaphragm assembly	ISS	biological process
GO:0032835	glomerulus development	IMP	biological process
GO:0016328	lateral plasma membrane	ISS	cellular component
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0003105	negative regulation of glomerular filtration	ISS	biological process
GO:0003105	negative regulation of glomerular filtration	ISS	biological process
GO:0000902	cell morphogenesis	ISS	biological process
GO:0072112	glomerular visceral epithelial cell differentiation	ISS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0016021	integral component of membrane	TAS	cellular component
GO:0002548	monocyte chemotaxis	IMP	biological process

Diseases

Associated diseases	References
Nephrotic syndrome	KEGG:H01657
Nephrotic syndrome	KEGG:H01657
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R