• Gene id: 5795

Gene Summary

• Gene Symbol: PTPRJ   Gene   UCSC   Ensembl
• Aliases: CD148, DEP1, HPTPeta, R-PTP-ETA, SCC1
• Gene name: protein tyrosine phosphatase, receptor type J
• Alternate names: receptor-type tyrosine-protein phosphatase eta, CD148 antigen, DEP-1, HPTP eta, R-PTP-J, density-enhanced phosphatase 1, human density enhanced phosphatase-1, protein tyrosine phosphatase, receptor type, J polypeptide, protein-tyrosine phosphatase eta, su,
• Gene location: 11p11.2 (47980503: 48170841)     Exons: 27     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes, including cell growth, differentiation, mitotic cycle, and oncogenic tra
• OMIM: 600925

Protein Summary

• Protein general information: Q12913  
  • Name: Receptor type tyrosine protein phosphatase eta (Protein tyrosine phosphatase eta) (R PTP eta) (EC 3.1.3.48) (Density enhanced phosphatase 1) (DEP 1) (HPTP eta) (Protein tyrosine phosphatase receptor type J) (R PTP J) (CD antigen CD148)
  • Length: 1337  
  • Mass: 145,941
• Sequence:

  MKPAAREARLPPRSPGLRWALPLLLLLLRLGQILCAGGTPSPIPDPSVATVATGENGITQISSTAESFHKQNGTG
  TPQVETNTSEDGESSGANDSLRTPEQGSNGTDGASQKTPSSTGPSPVFDIKAVSISPTNVILTWKSNDTAASEYK
  YVVKHKMENEKTITVVHQPWCNITGLRPATSYVFSITPGIGNETWGDPRVIKVITEPIPVSDLRVALTGVRKAAL
  SWSNGNGTASCRVLLESIGSHEELTQDSRLQVNISGLKPGVQYNINPYLLQSNKTKGDPLGTEGGLDASNTERSR
  AGSPTAPVHDESLVGPVDPSSGQQSRDTEVLLVGLEPGTRYNATVYSQAANGTEGQPQAIEFRTNAIQVFDVTAV
  NISATSLTLIWKVSDNESSSNYTYKIHVAGETDSSNLNVSEPRAVIPGLRSSTFYNITVCPVLGDIEGTPGFLQV
  HTPPVPVSDFRVTVVSTTEIGLAWSSHDAESFQMHITQEGAGNSRVEITTNQSIIIGGLFPGTKYCFEIVPKGPN
  GTEGASRTVCNRTVPSAVFDIHVVYVTTTEMWLDWKSPDGASEYVYHLVIESKHGSNHTSTYDKAITLQGLIPGT
  LYNITISPEVDHVWGDPNSTAQYTRPSNVSNIDVSTNTTAATLSWQNFDDASPTYSYCLLIEKAGNSSNATQVVT
  DIGITDATVTELIPGSSYTVEIFAQVGDGIKSLEPGRKSFCTDPASMASFDCEVVPKEPALVLKWTCPPGANAGF
  ELEVSSGAWNNATHLESCSSENGTEYRTEVTYLNFSTSYNISITTVSCGKMAAPTRNTCTTGITDPPPPDGSPNI
  TSVSHNSVKVKFSGFEASHGPIKAYAVILTTGEAGHPSADVLKYTYEDFKKGASDTYVTYLIRTEEKGRSQSLSE
  VLKYEIDVGNESTTLGYYNGKLEPLGSYRACVAGFTNITFHPQNKGLIDGAESYVSFSRYSDAVSLPQDPGVICG
  AVFGCIFGALVIVTVGGFIFWRKKRKDAKNNEVSFSQIKPKKSKLIRVENFEAYFKKQQADSNCGFAEEYEDLKL
  VGISQPKYAAELAENRGKNRYNNVLPYDISRVKLSVQTHSTDDYINANYMPGYHSKKDFIATQGPLPNTLKDFWR
  MVWEKNVYAIIMLTKCVEQGRTKCEEYWPSKQAQDYGDITVAMTSEIVLPEWTIRDFTVKNIQTSESHPLRQFHF
  TSWPDHGVPDTTDLLINFRYLVRDYMKQSPPESPILVHCSAGVGRTGTFIAIDRLIYQIENENTVDVYGIVYDLR
  MHRPLMVQTEDQYVFLNQCVLDIVRSQKDSKVDLIYQNTTAMTIYENLAPVTTFGKTNGYIA

• Structural information:
  • Protein Domains: Fibronectin (121-209)
    Fibronectin (207-291)
    Fibronectin (271-364)
    (368-456)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR029021  IPR000242   IPR016130  IPR003595  IPR000387  
  • Prosite: PS50853 PS00383 PS50056 PS50055
  • CDD: cd00063
  • PDB: 2CFV 2DLE 2NZ6
  • PDBsum: 2CFV 2DLE 2NZ6
  • STRING: ENSP00000400010
• Other Databases: GeneCards:  PTPRJ  Malacards:  PTPRJ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001772	immunological synapse	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0016791	phosphatase activity	IMP	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030155	regulation of cell adhesion	IMP	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0043116	negative regulation of vascular permeability	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IMP	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0060242	contact inhibition	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070097	delta-catenin binding	IPI	molecular function
GO:0070097	delta-catenin binding	IPI	molecular function
GO:0001772	immunological synapse	IDA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030054	cell junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0030155	regulation of cell adhesion	IMP	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0032587	ruffle membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0043116	negative regulation of vascular permeability	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IMP	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0060242	contact inhibition	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070097	delta-catenin binding	IPI	molecular function
GO:0070097	delta-catenin binding	IPI	molecular function
GO:0001772	immunological synapse	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0004725	protein tyrosine phosphatase activity	IMP	molecular function
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0005161	platelet-derived growth factor receptor binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0005911	cell-cell junction	IDA	cellular component
GO:0008013	beta-catenin binding	IPI	molecular function
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0008285	negative regulation of cell proliferation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:0016791	phosphatase activity	IMP	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IDA	molecular function
GO:0016791	phosphatase activity	IMP	molecular function
GO:0019901	protein kinase binding	IPI	molecular function
GO:0030155	regulation of cell adhesion	IMP	biological process
GO:0030308	negative regulation of cell growth	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IMP	biological process
GO:0042059	negative regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0043116	negative regulation of vascular permeability	IDA	biological process
GO:0043407	negative regulation of MAP kinase activity	IDA	biological process
GO:0045295	gamma-catenin binding	IPI	molecular function
GO:0045785	positive regulation of cell adhesion	IMP	biological process
GO:0048008	platelet-derived growth factor receptor signaling pathway	IMP	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IDA	biological process
GO:0050860	negative regulation of T cell receptor signaling pathway	IMP	biological process
GO:0050918	positive chemotaxis	IDA	biological process
GO:0051019	mitogen-activated protein kinase binding	IPI	molecular function
GO:0051894	positive regulation of focal adhesion assembly	IMP	biological process
GO:0051897	positive regulation of protein kinase B signaling	IMP	biological process
GO:0051898	negative regulation of protein kinase B signaling	IMP	biological process
GO:0060242	contact inhibition	NAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070097	delta-catenin binding	IPI	molecular function
GO:0070097	delta-catenin binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04520	Adherens junction

Diseases

Associated diseases	References
Asthenozoospermia	MIK: 20231113
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
20369545	Asthenozoospermia			6 seminal plasma samples were collected by Percoll respectively from healthy fertile and asthenozoospermia volunteers	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
20231113	Asthenozoospermia			12 (6 healthy fertile men, 6 asthenozoospermia volunteers)	Male infertility	annexin VI isoform 2 isoform 1 of interleukin-6 receptor subunit beta precursor Mr 400 000 protein cytosolic dynein heavy chain alpha-actinin-4 receptor-type tyrosine-protein phosphatase eta precursor vitamin D-binding protein precursor protein S10
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq