• Gene id: 5791

Gene Summary

• Gene Symbol: PTPRE   Gene   UCSC   Ensembl
• Aliases: HPTPE, PTPE, R-PTP-EPSILON
• Gene name: protein tyrosine phosphatase receptor type E
• Alternate names: receptor-type tyrosine-protein phosphatase epsilon, protein tyrosine phosphatase, receptor type, epsilon polypeptide,
• Gene location: 10q26.2 (127907052: 128085854)     Exons: 27     NC_000010.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran
• OMIM: 600926

Protein Summary

• Protein general information: P23469  
  • Name: Receptor type tyrosine protein phosphatase epsilon (Protein tyrosine phosphatase epsilon) (R PTP epsilon) (EC 3.1.3.48)
  • Length: 700  
  • Mass: 80642
  • Tissue specificity: Expressed in giant cell tumor (osteoclastoma rich in multinucleated osteoclastic cells). {ECO
• Sequence:

  MEPLCPLLLVGFSLPLARALRGNETTADSNETTTTSGPPDPGASQPLLAWLLLPLLLLLLVLLLAAYFFRFRKQR
  KAVVSTSDKKMPNGILEEQEQQRVMLLSRSPSGPKKYFPIPVEHLEEEIRIRSADDCKQFREEFNSLPSGHIQGT
  FELANKEENREKNRYPNILPNDHSRVILSQLDGIPCSDYINASYIDGYKEKNKFIAAQGPKQETVNDFWRMVWEQ
  KSATIVMLTNLKERKEEKCHQYWPDQGCWTYGNIRVCVEDCVVLVDYTIRKFCIQPQLPDGCKAPRLVSQLHFTS
  WPDFGVPFTPIGMLKFLKKVKTLNPVHAGPIVVHCSAGVGRTGTFIVIDAMMAMMHAEQKVDVFEFVSRIRNQRP
  QMVQTDMQYTFIYQALLEYYLYGDTELDVSSLEKHLQTMHGTTTHFDKIGLEEEFRKLTNVRIMKENMRTGNLPA
  NMKKARVIQIIPYDFNRVILSMKRGQEYTDYINASFIDGYRQKDYFIATQGPLAHTVEDFWRMIWEWKSHTIVML
  TEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI
  PAEGKGMIDLIAAVQKQQQQTGNHPITVHCSAGAGRTGTFIALSNILERVKAEGLLDVFQAVKSLRLQRPHMVQT
  LEQYEFCYKVVQDFIDIFSDYANFK

• Structural information:
  • Protein Domains: (135..39-)
    1 (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160-)
    (426..68-)
    2 (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR016130  IPR003595  IPR016336   IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • PDB: 2JJD 6D3F 6D4D 6D4F
  • PDBsum: 2JJD 6D3F 6D4D 6D4F
  • STRING: ENSP00000254667
• Other Databases: GeneCards:  PTPRE  Malacards:  PTPRE

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0046627	negative regulation of insulin receptor signaling pathway	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	TAS	molecular function
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0046627	negative regulation of insulin receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R