• Gene id: 5790

Gene Summary

• Gene Symbol: PTPRCAP   Gene   UCSC   Ensembl
• Aliases: CD45-AP, LPAP
• Gene name: protein tyrosine phosphatase receptor type C associated protein
• Alternate names: protein tyrosine phosphatase receptor type C-associated protein, CD45 associated protein, PTPRC-associated protein, lymphocyte phosphatase-associated phosphoprotein, protein tyrosine phosphatase, receptor type, c polypeptide-associated protein,
• Gene location: 11q13.2 (67437681: 67435509)     Exons: 2     NC_000011.10
• Gene summary(Entrez): The protein encoded by this gene was identified as a transmembrane phosphoprotein specifically associated with tyrosine phosphatase PTPRC/CD45, a key regulator of T- and B-lymphocyte activation. The interaction with PTPRC may be required for the stable ex
• OMIM: 147575

Protein Summary

• Protein general information: Q14761  
  • Name: Protein tyrosine phosphatase receptor type C associated protein (PTPRC associated protein) (CD45 associated protein) (CD45 AP) (Lymphocyte phosphatase associated phosphoprotein)
  • Length: 206  
  • Mass: 21196
• Sequence:

  MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRDSGGYYHPARLGAALW
  GRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVADGGLQADPGEGEQQCGEASSPEQVPVRAEEA
  RDSDTEGDLVLGSPGPASAGGSAEALLSDLHAFAGSAAWDDSARAAGGQGLHVTAL

• Structural information:
  • Interpro: IPR016553  
  • STRING: ENSP00000325589
• Other Databases: GeneCards:  PTPRCAP  Malacards:  PTPRCAP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006952	defense response	TAS	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881