• Gene id: 5788

Gene Summary

• Gene Symbol: PTPRC   Gene   UCSC   Ensembl
• Aliases: B220, CD45, CD45R, GP180, L-CA, LCA, LY5, T200
• Gene name: protein tyrosine phosphatase receptor type C
• Alternate names: receptor-type tyrosine-protein phosphatase C, CD45 antigen, T200 glycoprotein, T200 leukocyte common antigen, protein tyrosine phosphatase, receptor type, c polypeptide,
• Gene location: 1q31.3-q32.1 (198638967: 198757475)     Exons: 34     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitosis, and oncogenic transforma
• OMIM: 151460

Protein Summary

• Protein general information: P08575  
  • Name: Receptor type tyrosine protein phosphatase C (EC 3.1.3.48) (Leukocyte common antigen) (L CA) (T200) (CD antigen CD45)
  • Length: 1306  
  • Mass: 147486
  • Tissue specificity: Isoform 1
• Sequence:

  MTMYLWLKLLAFGFAFLDTEVFVTGQSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTS
  LSPDNTSTQVSPDSLDNASAFNTTGVSSVQTPHLPTHADSQTPSAGTDTQTFSGSAANAKLNPTPGSNAISDVPG
  ERSTASTFPTDPVSPLTTTLSLAHHSSAALPARTSNTTITANTSDAYLNASETTTLSPSGSAVISTTTIATTPSK
  PTCDEKYANITVDYLYNKETKLFTAKLNVNENVECGNNTCTNNEVHNLTECKNASVSISHNSCTAPDKTLILDVP
  PGVEKFQLHDCTQVEKADTTICLKWKNIETFTCDTQNITYRFQCGNMIFDNKEIKLENLEPEHEYKCDSEILYNN
  HKFTNASKIIKTDFGSPGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLK
  PYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAG
  NTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHSTSYNSKALIAFLAFLIIVTSIALLVVLYK
  IYDLHKKRSCNLDEQQELVERDDEKQLMNVEPIHADILLETYKRKIADEGRLFLAEFQSIPRVFSKFPIKEARKP
  FNQNKNRYVDILPYDYNRVELSEINGDAGSNYINASYIDGFKEPRKYIAAQGPRDETVDDFWRMIWEQKATVIVM
  VTRCEEGNRNKCAEYWPSMEEGTRAFGDVVVKINQHKRCPDYIIQKLNIVNKKEKATGREVTHIQFTSWPDHGVP
  EDPHLLLKLRRRVNAFSNFFSGPIVVHCSAGVGRTGTYIGIDAMLEGLEAENKVDVYGYVVKLRRQRCLMVQVEA
  QYILIHQALVEYNQFGETEVNLSELHPYLHNMKKRDPPSEPSPLEAEFQRLPSYRSWRTQHIGNQEENKSKNRNS
  NVIPYDYNRVPLKHELEMSKESEHDSDESSDDDSDSEEPSKYINASFIMSYWKPEVMIAAQGPLKETIGDFWQMI
  FQRKVKVIVMLTELKHGDQEICAQYWGEGKQTYGDIEVDLKDTDKSSTYTLRVFELRHSKRKDSRTVYQYQYTNW
  SVEQLPAEPKELISMIQVVKQKLPQKNSSEGNKHHKSTPLLIHCRDGSQQTGIFCALLNLLESAETEEVVDIFQV
  VKALRKARPGMVSTFEQYQFLYDVIASTYPAQNGQVKKNNHQEDKIEFDNEVDKVKQDANCVNPLGAPEKLPEAK
  EQAEGSEPTSGTEGPEHSVNGPASPALNQGS

• Structural information:
  • Protein Domains: (391..48-)
    1 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (484..57-)
    2 (/note="Fibronectin-type-III)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00316-)
    (653..91-)
    (/note="Tyrosine-protein-phosphatase)
  • Interpro: IPR003961  IPR036116  IPR013783  IPR029021  IPR024739   IPR000242  IPR016335  IPR016130  IPR003595  IPR000387  
  • Prosite: PS50853 PS00383 PS50056 PS50055
  • CDD: cd00063
  • PDB: 1YGR 1YGU 5FMV 5FN6 5FN7
  • PDBsum: 1YGR 1YGU 5FMV 5FN6 5FN7
  • DIP: 224
  • STRING: ENSP00000411355
• Other Databases: GeneCards:  PTPRC  Malacards:  PTPRC

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0030507	spectrin binding	IDA	molecular function
GO:0032059	bleb	IDA	cellular component
GO:0004725	protein tyrosine phosphatase activity	TAS	molecular function
GO:0004725	protein tyrosine phosphatase activity	ISS	molecular function
GO:0004725	protein tyrosine phosphatase activity	ISS	molecular function
GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	TAS	molecular function
GO:0005102	signaling receptor binding	ISS	molecular function
GO:0061097	regulation of protein tyrosine kinase activity	IDA	biological process
GO:0032677	regulation of interleukin-8 production	IDA	biological process
GO:0030506	ankyrin binding	IPI	molecular function
GO:0050764	regulation of phagocytosis	IDA	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	ISS	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	ISS	biological process
GO:1904155	DN2 thymocyte differentiation	TAS	biological process
GO:0098857	membrane microdomain	ISS	cellular component
GO:0009898	cytoplasmic side of plasma membrane	NAS	cellular component
GO:0045085	negative regulation of interleukin-2 biosynthetic process	ISS	biological process
GO:1903979	negative regulation of microglial cell activation	TAS	biological process
GO:0045121	membrane raft	ISS	cellular component
GO:0045121	membrane raft	ISS	cellular component
GO:0042110	T cell activation	TAS	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	ISS	biological process
GO:1905451	positive regulation of Fc-gamma receptor signaling pathway involved in phagocytosis	ISS	biological process
GO:0044855	plasma membrane raft distribution	ISS	biological process
GO:0043410	positive regulation of MAPK cascade	ISS	biological process
GO:1903615	positive regulation of protein tyrosine phosphatase activity	ISS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	ISS	biological process
GO:0010468	regulation of gene expression	ISS	biological process
GO:0010468	regulation of gene expression	ISS	biological process
GO:0031668	cellular response to extracellular stimulus	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0030183	B cell differentiation	ISS	biological process
GO:0001779	natural killer cell differentiation	ISS	biological process
GO:0046425	regulation of receptor signaling pathway via JAK-STAT	IGI	biological process
GO:0046425	regulation of receptor signaling pathway via JAK-STAT	IGI	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	ISS	biological process
GO:0030217	T cell differentiation	ISS	biological process
GO:0032760	positive regulation of tumor necrosis factor production	ISS	biological process
GO:0004725	protein tyrosine phosphatase activity	IBA	molecular function
GO:0006470	protein dephosphorylation	IBA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IBA	biological process
GO:0006469	negative regulation of protein kinase activity	IBA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016032	viral process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005001	transmembrane receptor protein tyrosine phosphatase activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030667	secretory granule membrane	TAS	cellular component
GO:0043312	neutrophil degranulation	TAS	biological process
GO:0050852	T cell receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:2001238	positive regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:0098857	membrane microdomain	IEA	cellular component
GO:0071944	cell periphery	IEA	cellular component
GO:0051726	regulation of cell cycle	IEA	biological process
GO:0051607	defense response to virus	IEA	biological process
GO:0050857	positive regulation of antigen receptor-mediated signaling pathway	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	IEA	biological process
GO:0045582	positive regulation of T cell differentiation	IEA	biological process
GO:0045121	membrane raft	IEA	cellular component
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IEA	biological process
GO:0045059	positive thymic T cell selection	IEA	biological process
GO:0042098	T cell proliferation	IEA	biological process
GO:0035584	calcium-mediated signaling using intracellular calcium source	IEA	biological process
GO:0034113	heterotypic cell-cell adhesion	IEA	biological process
GO:0031953	negative regulation of protein autophosphorylation	IEA	biological process
GO:0031668	cellular response to extracellular stimulus	IEA	biological process
GO:0030183	B cell differentiation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0007159	leukocyte cell-cell adhesion	IEA	biological process
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0002925	positive regulation of humoral immune response mediated by circulating immunoglobulin	IEA	biological process
GO:0002923	regulation of humoral immune response mediated by circulating immunoglobulin	IEA	biological process
GO:0002711	positive regulation of T cell mediated immunity	IEA	biological process
GO:0000187	activation of MAPK activity	IEA	biological process
GO:0010332	response to gamma radiation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:2001236	regulation of extrinsic apoptotic signaling pathway	IEA	biological process
GO:1905451	positive regulation of Fc-gamma receptor signaling pathway involved in phagocytosis	IEA	biological process
GO:1903615	positive regulation of protein tyrosine phosphatase activity	IEA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0061099	negative regulation of protein tyrosine kinase activity	IEA	biological process
GO:0051209	release of sequestered calcium ion into cytosol	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0050732	negative regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0048304	positive regulation of isotype switching to IgG isotypes	IEA	biological process
GO:0045588	positive regulation of gamma-delta T cell differentiation	IEA	biological process
GO:0045085	negative regulation of interleukin-2 biosynthetic process	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0044855	plasma membrane raft distribution	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0043395	heparan sulfate proteoglycan binding	IEA	molecular function
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0042100	B cell proliferation	IEA	biological process
GO:0032760	positive regulation of tumor necrosis factor production	IEA	biological process
GO:0030890	positive regulation of B cell proliferation	IEA	biological process
GO:0030217	T cell differentiation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0010468	regulation of gene expression	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0006469	negative regulation of protein kinase activity	IEA	biological process
GO:0005925	focal adhesion	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0001960	negative regulation of cytokine-mediated signaling pathway	IEA	biological process
GO:0001916	positive regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0001915	negative regulation of T cell mediated cytotoxicity	IEA	biological process
GO:0001779	natural killer cell differentiation	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0010468	regulation of gene expression	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IEA	biological process
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:0050852	T cell receptor signaling pathway	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051726	regulation of cell cycle	ISS	biological process
GO:0048539	bone marrow development	IMP	biological process
GO:2000648	positive regulation of stem cell proliferation	IMP	biological process
GO:0051209	release of sequestered calcium ion into cytosol	ISS	biological process
GO:0044770	cell cycle phase transition	IMP	biological process
GO:0042102	positive regulation of T cell proliferation	ISS	biological process
GO:0042100	B cell proliferation	ISS	biological process
GO:0006469	negative regulation of protein kinase activity	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0002244	hematopoietic progenitor cell differentiation	IMP	biological process
GO:0001960	negative regulation of cytokine-mediated signaling pathway	ISS	biological process
GO:0070062	extracellular exosome	HDA	cellular component
GO:2000473	positive regulation of hematopoietic stem cell migration	IMP	biological process
GO:0051607	defense response to virus	ISS	biological process
GO:0050857	positive regulation of antigen receptor-mediated signaling pathway	ISS	biological process
GO:0050853	B cell receptor signaling pathway	ISS	biological process
GO:0048864	stem cell development	IMP	biological process
GO:0016311	dephosphorylation	ISS	biological process
GO:0006470	protein dephosphorylation	ISS	biological process
GO:0016020	membrane	HDA	cellular component
GO:0045860	positive regulation of protein kinase activity	NAS	biological process
GO:0030890	positive regulation of B cell proliferation	IMP	biological process
GO:0030217	T cell differentiation	ISS	biological process
GO:0019901	protein kinase binding	IPI	molecular function
GO:0006933	negative regulation of cell adhesion involved in substrate-bound cell migration	IMP	biological process
GO:0005925	focal adhesion	ISS	cellular component
GO:0005887	integral component of plasma membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0002378	immunoglobulin biosynthetic process	IMP	biological process
GO:0001915	negative regulation of T cell mediated cytotoxicity	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa04514	Cell adhesion molecules
hsa04660	T cell receptor signaling pathway
hsa04666	Fc gamma R-mediated phagocytosis
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
T-B+Severe combined immunodeficiency	KEGG:H00091
T-B+Severe combined immunodeficiency	KEGG:H00091
Multiple sclerosis	PMID:11101853
severe combined immunodeficiency	PMID:11145714
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)