• Gene id: 57864

Gene Summary

• Gene Symbol: SLC46A2   Gene   UCSC   Ensembl
• Aliases: Ly110, TSCOT
• Gene name: solute carrier family 46 member 2
• Alternate names: thymic stromal cotransporter homolog, thymic stromal co-transporter,
• Gene location: 9q32 (112895537: 112878919)     Exons: 4     NC_000009.12
• OMIM: 606160

Protein Summary

• Protein general information: Q9BY10  
  • Name: Thymic stromal cotransporter homolog (Solute carrier family 46 member 2)
  • Length: 475  
  • Mass: 51067
  • Tissue specificity: Strongly expressed in the adult thymus. Expressed in spleen, lymph nodes, thymus, PBL, bone marrow and fetal liver. {ECO
• Sequence:

  MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASPSPRGALEDQQQRAIS
  NFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSRLGLLLKVLLDWPVEVLYGAAALNGLFGGFS
  AFWSGVMALGSLGSSEGRRSVRLILIDLMLGLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLL
  VLKVPESVAKPSQELPAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGT
  VDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGSGALLLAFVKETYMFY
  IARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGVVTSTLYNKIYQLTMDMFVGSCFALSSFLSF
  LAIIPISIVAYKQVPLSPYGDIIEK

• Structural information:
  • Interpro: IPR011701  IPR036259  IPR001958  
  • STRING: ENSP00000363345
• Other Databases: GeneCards:  SLC46A2  Malacards:  SLC46A2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070430	positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IMP	biological process
GO:0048538	thymus development	IEA	biological process
GO:0045580	regulation of T cell differentiation	IEA	biological process
GO:0043029	T cell homeostasis	IEA	biological process
GO:0070233	negative regulation of T cell apoptotic process	IEA	biological process
GO:0009986	cell surface	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0015293	symporter activity	NAS	molecular function

Diseases

Associated diseases	References
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray