• Gene id: 57863

Gene Summary

• Gene Symbol: CADM3   Gene   UCSC   Ensembl
• Aliases: BIgR, IGSF4B, NECL1, Necl-1, TSLL1, synCAM3
• Gene name: cell adhesion molecule 3
• Alternate names: cell adhesion molecule 3, TSLC1-like 1, brain immunoglobulin receptor, dendritic cell nectin-like protein 1 short isoform, immunoglobulin superfamily member 4B, synaptic cell adhesion molecule 3,
• Gene location: 1q23.2 (159171591: 159203312)     Exons: 12     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is a calcium-independent cell-cell adhesion protein that can form homodimers or heterodimers with other nectin proteins. The encoded protein has both homophilic and heterophilic cell-cell adhesion activity. This gene is re
• OMIM: 186745

Protein Summary

• Protein general information: Q8N126  
  • Name: Cell adhesion molecule 3 (Brain immunoglobulin receptor) (Immunoglobulin superfamily member 4B) (IgSF4B) (Nectin like protein 1) (NECL 1) (Synaptic cell adhesion molecule 3) (SynCAM3) (TSLC1 like protein 1) (TSLL1)
  • Length: 398  
  • Mass: 43300
  • Tissue specificity: Isoform 1 is expressed mainly in adult and fetal brain. Isoform 2 is highly expressed in adult brain and weakly expressed in placenta. In brain, Isoform 2 is highly expressed in cerebellum. {ECO
• Sequence:

  MGAPAASLLLLLLLFACCWAPGGANLSQDDSQPWTSDETVVAGGTVVLKCQVKDHEDSSLQWSNPAQQTLYFGEK
  RALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGIPQKPIITGYKSSLREKDTATL
  NCQSSGSKPAARLTWRKGDQELHGEPTRIQEDPNGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRSTSQ
  RIEVLYTPTAMIRPDPPHPREGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKMTQESALIFPFLNKSDSGTYGCT
  ATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVFLLLIMLIFLGHYLIRHKGTYLTHEAKGSDDAPD
  ADTAIINAEGGQSGGDDKKEYFI

• Structural information:
  • Protein Domains: (25..12-)
    (/note="Ig-like-V-type)
    (130..22-)
    1 (/note="Ig-like-C2-type)
    (233..31-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR013162  IPR007110  IPR036179  IPR013783  IPR003599   IPR003598  IPR013106  IPR003585  
  • Prosite: PS50835
  • PDB: 1Z9M
  • PDBsum: 1Z9M
  • STRING: ENSP00000357106
• Other Databases: GeneCards:  CADM3  Malacards:  CADM3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	ISS	biological process
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	ISS	biological process
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0005911	cell-cell junction	ISS	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0034332	adherens junction organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005911	cell-cell junction	IEA	cellular component
GO:0007157	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IEA	biological process
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0098688	parallel fiber to Purkinje cell synapse	IEA	cellular component
GO:0007156	homophilic cell adhesion via plasma membrane adhesion molecules	IEA	biological process
GO:0008104	protein localization	IEA	biological process
GO:0099056	integral component of presynaptic membrane	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881