• Gene id: 57834

Gene Summary

• Gene Symbol: CYP4F11   Gene   UCSC   Ensembl
• Aliases: CYPIVF11
• Gene name: cytochrome P450 family 4 subfamily F member 11
• Alternate names: cytochrome P450 4F11, 3-hydroxy fatty acids omega-hydroxylase CYP4F11, cytochrome P450, family 4, subfamily F, polypeptide 11, cytochrome P450, subfamily IVF, polypeptide 11, docosahexaenoic acid omega-hydroxylase, long-chain fatty acid omega-monooxygenase, phy,
• Gene location: 19p13.12 (15934865: 15912369)     Exons: 13     NC_000019.10
• Gene summary(Entrez): This gene, CYP4F11, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This gen
• OMIM: 609585

Protein Summary

• Protein general information: Q9HBI6  
  • Name: Cytochrome P450 4F11 (CYPIVF11) (EC 1.14.14.1) (3 hydroxy fatty acids omega hydroxylase CYP4F11) (Docosahexaenoic acid omega hydroxylase) (EC 1.14.14.79) (Long chain fatty acid omega monooxygenase) (EC 1.14.14.80) (Phylloquinone omega hydroxylase CYP4F11)
  • Length: 524  
  • Mass: 60146
  • Tissue specificity: Expressed mainly in human liver, followed by kidney, heart, and skeletal muscle. {ECO
• Sequence:

  MPQLSLSWLGLGPVAASPWLLLLLVGGSWLLARVLAWTYTFYDNCRRLQCFPQPPKQNWFWGHQGLVTPTEEGMK
  TLTQLVTTYPQGFKLWLGPTFPLLILCHPDIIRPITSASAAVAPKDMIFYGFLKPWLGDGLLLSGGDKWSRHRRM
  LTPAFHFNILKPYMKIFNKSVNIMHDKWQRLASEGSARLDMFEHISLMTLDSLQKCVFSFESNCQEKPSEYIAAI
  LELSAFVEKRNQQILLHTDFLYYLTPDGQRFRRACHLVHDFTDAVIQERRCTLPTQGIDDFLKNKAKSKTLDFID
  VLLLSKDEDGKELSDEDIRAEADTFMFEGHDTTASGLSWVLYHLAKHPEYQEQCRQEVQELLKDREPIEIEWDDL
  AQLPFLTMCIKESLRLHPPVPVISRCCTQDFVLPDGRVIPKGIVCLINIIGIHYNPTVWPDPEVYDPFRFDQENI
  KERSPLAFIPFSAGPRNCIGQAFAMAEMKVVLALTLLHFRILPTHTEPRRKPELILRAEGGLWLRVEPLGANSQ

• Structural information:
  • Interpro: IPR001128  IPR017972  IPR002401  IPR036396  
  • Prosite: PS00086
  • STRING: ENSP00000384588
• Other Databases: GeneCards:  CYP4F11  Malacards:  CYP4F11

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0019369	arachidonic acid metabolic process	IBA	biological process
GO:0036101	leukotriene B4 catabolic process	IBA	biological process
GO:0042377	vitamin K catabolic process	IBA	biological process
GO:0004497	monooxygenase activity	IBA	molecular function
GO:0008391	arachidonic acid monooxygenase activity	IBA	molecular function
GO:0042361	menaquinone catabolic process	IBA	biological process
GO:0042376	phylloquinone catabolic process	IBA	biological process
GO:0043231	intracellular membrane-bounded organelle	IBA	cellular component
GO:0050051	leukotriene-B4 20-monooxygenase activity	IBA	molecular function
GO:0055114	oxidation-reduction process	IBA	biological process
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IDA	molecular function
GO:0042361	menaquinone catabolic process	IDA	biological process
GO:0042376	phylloquinone catabolic process	IDA	biological process
GO:0042377	vitamin K catabolic process	IDA	biological process
GO:0007596	blood coagulation	TAS	biological process
GO:0005506	iron ion binding	IEA	molecular function
GO:0020037	heme binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016705	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen	IEA	molecular function
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0004497	monooxygenase activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006631	fatty acid metabolic process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0006629	lipid metabolic process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0070330	aromatase activity	IEA	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016709	oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen	IDA	molecular function
GO:0005504	fatty acid binding	IDA	molecular function
GO:0006631	fatty acid metabolic process	IDA	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0031090	organelle membrane	IEA	cellular component
GO:0042376	phylloquinone catabolic process	IEA	biological process
GO:0031408	oxylipin biosynthetic process	IEA	biological process
GO:0019369	arachidonic acid metabolic process	IEA	biological process
GO:0006954	inflammatory response	TAS	biological process
GO:0055114	oxidation-reduction process	TAS	biological process
GO:0020037	heme binding	TAS	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray