• Gene id: 57826

Gene Summary

• Gene Symbol: RAP2C   Gene   UCSC   Ensembl
• Gene name: RAP2C, member of RAS oncogene family
• Alternate names: ras-related protein Rap-2c, small GTPase RAP2C,
• Gene location: Xq26.2 (10454684: 10441672)     Exons: 9     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a member of the Ras-related protein subfamily of the Ras GTPase superfamily. Members of this family are small GTPases that act as molecular switches to regulate cellular proliferation, differentiation, and apoptosis. Th
• OMIM: 301016

Protein Summary

• Protein general information: Q9Y3L5  
  • Name: Ras related protein Rap 2c
  • Length: 183  
  • Mass: 20745
  • Tissue specificity: Expressed in liver, skeletal muscle, prostate, uterus, rectum, stomach, and bladder and to a lower extent in brain, kidney, pancreas, and bone marrow. Expressed in mononuclear leukocytes and megakaryocytes. {ECO
• Sequence:

  MREYKVVVLGSGGVGKSALTVQFVTGTFIEKYDPTIEDFYRKEIEVDSSPSVLEILDTAGTEQFASMRDLYIKNG
  QGFILVYSLVNQQSFQDIKPMRDQIVRVKRYEKVPLILVGNKVDLEPEREVMSSEGRALAQEWGCPFMETSAKSK
  SMVDELFAEIVRQMNYSSLPEKQDQCCTTCVVQ

• Structural information:
  • Interpro: IPR027417  IPR041840  IPR005225  IPR001806  IPR020849  
  • Prosite: PS51421
  • CDD: cd04176
  • STRING: ENSP00000340274
• Other Databases: GeneCards:  RAP2C  Malacards:  RAP2C

KEGG pathways

Pathway id	Pathway name
hsa04530	Tight junction

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881