• Gene id: 57823

Gene Summary

• Gene Symbol: SLAMF7   Gene   UCSC   Ensembl
• Aliases: 19A, CD319, CRACC, CS1
• Gene name: SLAM family member 7
• Alternate names: SLAM family member 7, 19A24 protein, CD2 subset 1, CD2-like receptor activating cytotoxic cells, membrane protein FOAP-12, novel LY9 (lymphocyte antigen 9) like protein, protein 19A,
• Gene location: 1q23.3 (160739056: 160754820)     Exons: 7     NC_000001.11

Protein Summary

• Protein general information: Q9NQ25  
  • Name: SLAM family member 7 (CD2 subset 1) (CD2 like receptor activating cytotoxic cells) (CRACC) (Membrane protein FOAP 12) (Novel Ly9) (Protein 19A) (CD antigen CD319)
  • Length: 335  
  • Mass: 37421
  • Tissue specificity: Expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-ce
• Sequence:

  MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQN
  RNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLT
  CCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSS
  MVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA
  NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI

• Structural information:
  • Protein Domains: (23..12-)
    (/note="Ig-like-V-type)
    (131..20-)
    (/note="Ig-like-C2-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR013106  
  • Prosite: PS50835
  • STRING: ENSP00000357022
• Other Databases: GeneCards:  SLAMF7  Malacards:  SLAMF7

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002376	immune system process	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002250	adaptive immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050776	regulation of immune response	TAS	biological process
GO:0042802	identical protein binding	IPI	molecular function
GO:0042802	identical protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0042267	natural killer cell mediated cytotoxicity	NAS	biological process
GO:0030101	natural killer cell activation	NAS	biological process
GO:0007155	cell adhesion	NAS	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881