• Gene id: 5782

Gene Summary

• Gene Symbol: PTPN12   Gene   UCSC   Ensembl
• Aliases: PTP-PEST, PTPG1
• Gene name: protein tyrosine phosphatase non-receptor type 12
• Alternate names: tyrosine-protein phosphatase non-receptor type 12, protein-tyrosine phosphatase G1,
• Gene location: 7q11.23 (77537189: 77640068)     Exons: 19     NC_000007.14
• Gene summary(Entrez): The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.
• OMIM: 605328

Protein Summary

• Protein general information: Q05209  
  • Name: Tyrosine protein phosphatase non receptor type 12 (EC 3.1.3.48) (PTP PEST) (Protein tyrosine phosphatase G1) (PTPG1)
  • Length: 780  
  • Mass: 88106
• Sequence:

  MEQVEILRKFIQRVQAMKSPDHNGEDNFARDFMRLRRLSTKYRTEKIYPTATGEKEENVKKNRYKDILPFDHSRV
  KLTLKTPSQDSDYINANFIKGVYGPKAYVATQGPLANTVIDFWRMIWEYNVVIIVMACREFEMGRKKCERYWPLY
  GEDPITFAPFKISCEDEQARTDYFIRTLLLEFQNESRRLYQFHYVNWPDHDVPSSFDSILDMISLMRKYQEHEDV
  PICIHCSAGCGRTGAICAIDYTWNLLKAGKIPEEFNVFNLIQEMRTQRHSAVQTKEQYELVHRAIAQLFEKQLQL
  YEIHGAQKIADGVNEINTENMVSSIEPEKQDSPPPKPPRTRSCLVEGDAKEEILQPPEPHPVPPILTPSPPSAFP
  TVTTVWQDNDRYHPKPVLHMVSSEQHSADLNRNYSKSTELPGKNESTIEQIDKKLERNLSFEIKKVPLQEGPKSF
  DGNTLLNRGHAIKIKSASPCIADKISKPQELSSDLNVGDTSQNSCVDCSVTQSNKVSVTPPEESQNSDTPPRPDR
  LPLDEKGHVTWSFHGPENAIPIPDLSEGNSSDINYQTRKTVSLTPSPTTQVETPDLVDHDNTSPLFRTPLSFTNP
  LHSDDSDSDERNSDGAVTQNKTNISTASATVSAATSTESISTRKVLPMSIARHNIAGTTHSGAEKDVDVSEDSPP
  PLPERTPESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQI
  SENPTEATDIGFGNRCGKPKGPRDPPSEWT

• Structural information:
  • Protein Domains: (28..29-)
    (/note="Tyrosine-protein-phosphatase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00160"-)
  • Interpro: IPR029021  IPR000242  IPR012266  IPR016130  IPR003595   IPR000387  
  • Prosite: PS00383 PS50056 PS50055
  • PDB: 5HDE 5J8R 5O2P
  • PDBsum: 5HDE 5J8R 5O2P
  • STRING: ENSP00000248594
• Other Databases: GeneCards:  PTPN12  Malacards:  PTPN12

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	IBA	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IBA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0005634	nucleus	IBA	cellular component
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	IBA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IDA	molecular function
GO:0006470	protein dephosphorylation	IDA	biological process
GO:0035335	peptidyl-tyrosine dephosphorylation	IDA	biological process
GO:0042058	regulation of epidermal growth factor receptor signaling pathway	IMP	biological process
GO:0071364	cellular response to epidermal growth factor stimulus	IMP	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016791	phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0004726	non-membrane spanning protein tyrosine phosphatase activity	TAS	molecular function
GO:0005737	cytoplasm	TAS	cellular component
GO:0006470	protein dephosphorylation	TAS	biological process
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0004725	protein tyrosine phosphatase activity	EXP	molecular function
GO:0071345	cellular response to cytokine stimulus	TAS	biological process
GO:2000587	negative regulation of platelet-derived growth factor receptor-beta signaling pathway	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0038128	ERBB2 signaling pathway	TAS	biological process
GO:1901185	negative regulation of ERBB signaling pathway	TAS	biological process
GO:1901185	negative regulation of ERBB signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0004725	protein tyrosine phosphatase activity	IEA	molecular function
GO:0002102	podosome	IEA	cellular component
GO:0004721	phosphoprotein phosphatase activity	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0006470	protein dephosphorylation	IEA	biological process
GO:0042246	tissue regeneration	IEA	biological process
GO:0002102	podosome	IEA	cellular component
GO:0005925	focal adhesion	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0017124	SH3 domain binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq