• Gene id: 57818

Gene Summary

• Gene Symbol: G6PC2   Gene   UCSC   Ensembl
• Aliases: IGRP
• Gene name: glucose-6-phosphatase catalytic subunit 2
• Alternate names: glucose-6-phosphatase 2, G-6-Pase 2, G6Pase 2, glucose-6-phosphatase, catalytic, 2, islet-specific G6CP-related protein, islet-specific glucose-6-phosphatase catalytic subunit-related protein, islet-specific glucose-6-phosphatase-related protein,
• Gene location: 2q31.1 (168901222: 168909999)     Exons: 5     NC_000002.12
• Gene summary(Entrez): This gene encodes an enzyme belonging to the glucose-6-phosphatase catalytic subunit family. These enzymes are part of a multicomponent integral membrane system that catalyzes the hydrolysis of glucose-6-phosphate, the terminal step in gluconeogenic and g
• OMIM: 300456

Protein Summary

• Protein general information: Q9NQR9  
  • Name: Glucose 6 phosphatase 2 (G 6 Pase 2) (G6Pase 2) (EC 3.1.3.9) (Islet specific glucose 6 phosphatase catalytic subunit related protein)
  • Length: 355  
  • Mass: 40580
  • Tissue specificity: Specifically expressed in pancreas and also detected to a lower extent in testis. Expressed by most islet cells in the pancreas (at protein level). {ECO
• Sequence:

  MDFLHRNGVLIIQHLQKDYRAYYTFLNFMSNVGDPRNIFFIYFPLCFQFNQTVGTKMIWVAVIGDWLNLIFKWIL
  FGHRPYWWVQETQIYPNHSSPCLEQFPTTCETGPGSPSGHAMGASCVWYVMVTAALSHTVCGMDKFSITLHRLTW
  SFLWSVFWLIQISVCISRVFIATHFPHQVILGVIGGMLVAEAFEHTPGIQTASLGTYLKTNLFLFLFAVGFYLLL
  RVLNIDLLWSVPIAKKWCANPDWIHIDTTPFAGLVRNLGVLFGLGFAINSEMFLLSCRGGNNYTLSFRLLCALTS
  LTILQLYHFLQIPTHEEHLFYVLSFCKSASIPLTVVAFIPYSVHMLMKQSGKKSQ

• Structural information:
  • Interpro: IPR016275  IPR036938  IPR000326  
  • STRING: ENSP00000364512
• Other Databases: GeneCards:  G6PC2  Malacards:  G6PC2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006094	gluconeogenesis	IBA	biological process
GO:0004346	glucose-6-phosphatase activity	IBA	molecular function
GO:0051156	glucose 6-phosphate metabolic process	IBA	biological process
GO:0004346	glucose-6-phosphatase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006094	gluconeogenesis	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004346	glucose-6-phosphatase activity	IEA	molecular function
GO:0004346	glucose-6-phosphatase activity	EXP	molecular function
GO:0005789	endoplasmic reticulum membrane	TAS	cellular component
GO:0006094	gluconeogenesis	TAS	biological process
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0042593	glucose homeostasis	IMP	biological process
GO:0050796	regulation of insulin secretion	IMP	biological process
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0016311	dephosphorylation	IEA	biological process
GO:0006094	gluconeogenesis	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa04151	PI3K-Akt signaling pathway
hsa04910	Insulin signaling pathway
hsa04152	AMPK signaling pathway
hsa04068	FoxO signaling pathway
hsa04922	Glucagon signaling pathway
hsa04931	Insulin resistance
hsa00010	Glycolysis / Gluconeogenesis
hsa04920	Adipocytokine signaling pathway
hsa04973	Carbohydrate digestion and absorption
hsa00500	Starch and sucrose metabolism
hsa00052	Galactose metabolism

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R